KEGG   Bordetella parapertussis 12822: BPP3663Help
Entry
BPP3663           CDS       T00140                                 

Gene name
pykA
Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
bpa  Bordetella parapertussis 12822
Pathway
bpa00010  Glycolysis / Gluconeogenesis
bpa00230  Purine metabolism
bpa00620  Pyruvate metabolism
bpa01100  Metabolic pathways
bpa01110  Biosynthesis of secondary metabolites
bpa01120  Microbial metabolism in diverse environments
bpa01130  Biosynthesis of antibiotics
bpa01200  Carbon metabolism
bpa01230  Biosynthesis of amino acids
Module
bpa_M00002  Glycolysis, core module involving three-carbon compounds
bpa_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
bpa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPP3663 (pykA)
   00620 Pyruvate metabolism
    BPP3663 (pykA)
  Nucleotide metabolism
   00230 Purine metabolism
    BPP3663 (pykA)
Enzymes [BR:bpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     BPP3663 (pykA)
Membrane trafficking [BR:bpa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BPP3663 (pykA)
Exosome [BR:bpa04147]
 Exosomal proteins
  Proteins found in most exosomes
   BPP3663 (pykA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C Optomotor-blind
Motif
Other DBs
NCBI-ProteinID: CAE38947
GeneDB: BPP3663
UniProt: Q7W4J7
LinkDB All DBs
Position
complement(3959890..3961332)
Genome map
AA seq 480 aa AA seqDB search
MPVLRRTKIVATLGPATSTPERLDGLIRAGMDVARLNFSHGSAQDHRERVRLVRELAAEQ
GRFVALMGDLQGPKIRIARFTDQQVTLQAGQPFTLSRSHSKEAGDATIVGIDYPELVQDC
RPGDELLLDDGRVVLVVDSVGAEEVHTTVTVGGPLSNNKGINRRGGGLSAPSLTDKDRTD
IKLAAEMELDYVAVSFPRYGADIDEARALLRAAGSQAWIIAKIERAEAVADDDALDALIR
ASDGVMVARGDLGVEVGDAELVGIQKRIIQHARTLNKVVITATQMMESMVASPMPTRAEV
SDVANAVLDYTDAVMLSAESASGQYPIEAVAAMARVCLGAEKHPTTTHSHHRLGETFTRC
DETIALAAMYAANHFPGVKAIIALTESGHTPLIMSRIRSGVPIYCYSPHGPTQRRAALFR
GVYTVPFAPAEYDPADLSNAAIDELKKRGRVAAGDWVILTKGDFYRDSGGTNGLKILKVE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtactgcgccgcaccaaaatcgttgccaccctggggcccgccacgtccacgccc
gagcggctcgacgggctgatacgcgccggcatggacgtggcccgcctgaatttctcgcac
ggcagcgcgcaggaccatcgcgagcgcgtgcggctggtgcgcgagctggcggccgagcaa
gggcgcttcgtggccctcatgggcgacttgcagggcccgaagatccggatcgcccgcttc
accgaccagcaggtcaccctgcaggccggccagcctttcacgctgtcgcgttcacattcc
aaggaggccggcgacgcaaccatcgtgggtatcgattatcccgagctggtgcaggactgc
cgccctggcgacgagctgctgctcgacgatggccgcgtggtgctggtggtcgacagcgtg
ggggccgaggaggtccacaccaccgtgacggtgggcgggccgctgtcgaacaacaagggc
atcaaccggcgcggcggcggcctttcggcgcccagcctcaccgacaaggaccgcaccgac
atcaagctggccgccgagatggagctggactacgtggccgtatcgtttccgcgctatggg
gccgacatcgatgaagcccgcgcgctgctgcgcgcggccggcagccaggcctggatcatc
gccaagatcgagcgcgccgaggcggtggccgacgacgacgcgctggatgcgctgatccgc
gccagcgacggcgtgatggtggcgcgcggcgacctgggcgtggaagtgggcgacgccgaa
ctggtcggcatccagaagcgcatcatccagcacgcgcgtacgctgaacaaggtggtcatc
acggccacccagatgatggagtccatggtggccagccccatgcccacgcgcgccgaggtg
tcggacgtggccaacgcggtgctcgactacacggacgccgtcatgctgtcggccgaaagc
gcctcgggccagtatccgatcgaggcggtggcggcgatggcacgggtctgtctgggggcg
gagaagcaccctaccaccacgcattcgcaccatcgcctgggcgagacgttcacgcgctgc
gacgagaccatcgcgctggcggccatgtacgcggccaaccatttcccgggcgtgaaggcc
atcatcgcgctgaccgaaagcgggcacacgccgctgatcatgtcgcgcatccgttcgggc
gtgccgatctactgctacagcccgcatggtcccacgcagcggcgcgcggcgctgtttcgc
ggcgtctacacggtgcccttcgcgccggccgaatacgacccggccgacttgagcaacgcg
gccatcgacgagctgaagaagcgtggccgtgtcgcggcgggcgactgggtcatcctgacc
aagggcgatttctaccgcgacagcggcggcaccaacggcctgaagatcctgaaggtggaa
tag

DBGET integrated database retrieval system