KEGG   Bordetella parapertussis 12822: BPP3663Help
Entry
BPP3663           CDS       T00140                                 

Gene name
pykA
Definition
(RefSeq) pyruvate kinase (EC:2.7.1.40)
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BPP3663 (pykA)
   01230 Biosynthesis of amino acids
    BPP3663 (pykA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BPP3663 (pykA)
   00620 Pyruvate metabolism
    BPP3663 (pykA)
  Nucleotide metabolism
   00230 Purine metabolism
    BPP3663 (pykA)
Enzymes [BR:bpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     BPP3663 (pykA)
Exosome [BR:bpa04147]
 Exosomal proteins
  Proteins found in most exosomes
   BPP3663 (pykA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
LinkDB All DBs
Position
complement(3959890..3961332)
Genome map
AA seq 480 aa AA seqDB search
MPVLRRTKIVATLGPATSTPERLDGLIRAGMDVARLNFSHGSAQDHRERVRLVRELAAEQ
GRFVALMGDLQGPKIRIARFTDQQVTLQAGQPFTLSRSHSKEAGDATIVGIDYPELVQDC
RPGDELLLDDGRVVLVVDSVGAEEVHTTVTVGGPLSNNKGINRRGGGLSAPSLTDKDRTD
IKLAAEMELDYVAVSFPRYGADIDEARALLRAAGSQAWIIAKIERAEAVADDDALDALIR
ASDGVMVARGDLGVEVGDAELVGIQKRIIQHARTLNKVVITATQMMESMVASPMPTRAEV
SDVANAVLDYTDAVMLSAESASGQYPIEAVAAMARVCLGAEKHPTTTHSHHRLGETFTRC
DETIALAAMYAANHFPGVKAIIALTESGHTPLIMSRIRSGVPIYCYSPHGPTQRRAALFR
GVYTVPFAPAEYDPADLSNAAIDELKKRGRVAAGDWVILTKGDFYRDSGGTNGLKILKVE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtactgcgccgcaccaaaatcgttgccaccctggggcccgccacgtccacgccc
gagcggctcgacgggctgatacgcgccggcatggacgtggcccgcctgaatttctcgcac
ggcagcgcgcaggaccatcgcgagcgcgtgcggctggtgcgcgagctggcggccgagcaa
gggcgcttcgtggccctcatgggcgacttgcagggcccgaagatccggatcgcccgcttc
accgaccagcaggtcaccctgcaggccggccagcctttcacgctgtcgcgttcacattcc
aaggaggccggcgacgcaaccatcgtgggtatcgattatcccgagctggtgcaggactgc
cgccctggcgacgagctgctgctcgacgatggccgcgtggtgctggtggtcgacagcgtg
ggggccgaggaggtccacaccaccgtgacggtgggcgggccgctgtcgaacaacaagggc
atcaaccggcgcggcggcggcctttcggcgcccagcctcaccgacaaggaccgcaccgac
atcaagctggccgccgagatggagctggactacgtggccgtatcgtttccgcgctatggg
gccgacatcgatgaagcccgcgcgctgctgcgcgcggccggcagccaggcctggatcatc
gccaagatcgagcgcgccgaggcggtggccgacgacgacgcgctggatgcgctgatccgc
gccagcgacggcgtgatggtggcgcgcggcgacctgggcgtggaagtgggcgacgccgaa
ctggtcggcatccagaagcgcatcatccagcacgcgcgtacgctgaacaaggtggtcatc
acggccacccagatgatggagtccatggtggccagccccatgcccacgcgcgccgaggtg
tcggacgtggccaacgcggtgctcgactacacggacgccgtcatgctgtcggccgaaagc
gcctcgggccagtatccgatcgaggcggtggcggcgatggcacgggtctgtctgggggcg
gagaagcaccctaccaccacgcattcgcaccatcgcctgggcgagacgttcacgcgctgc
gacgagaccatcgcgctggcggccatgtacgcggccaaccatttcccgggcgtgaaggcc
atcatcgcgctgaccgaaagcgggcacacgccgctgatcatgtcgcgcatccgttcgggc
gtgccgatctactgctacagcccgcatggtcccacgcagcggcgcgcggcgctgtttcgc
ggcgtctacacggtgcccttcgcgccggccgaatacgacccggccgacttgagcaacgcg
gccatcgacgagctgaagaagcgtggccgtgtcgcggcgggcgactgggtcatcctgacc
aagggcgatttctaccgcgacagcggcggcaccaacggcctgaagatcctgaaggtggaa
tag

DBGET integrated database retrieval system