KEGG   Bordetella parapertussis 12822: BPP4173Help
Entry
BPP4173           CDS       T00140                                 

Definition
(GenBank) probable aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
bpa  Bordetella parapertussis 12822
Pathway
bpa00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bpa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BPP4173
Enzymes [BR:bpa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BPP4173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC RbcS DUF4375
Motif
Other DBs
NCBI-ProteinID: CAE39452
GeneDB: BPP4173
UniProt: Q7W373
LinkDB All DBs
Position
complement(4506028..4507488)
Genome map
AA seq 486 aa AA seqDB search
MEDLRNHEFKNYIGGQWVACAAGKTYPNVNPADTDDIVGRFQASQAEDAAAAVAAAQAAF
DGWRNLAVSKRAALMQRAADYLEAHAEQFGRELTREEGKALNLAKDEVLRSAQTIRFYAA
EGQSFSGETFVNDDPDMVVYSQREPLGVVTVISPWNFPVSIPARKIAPALITGNTVVFKP
SSDAPLSGLRLVEAFEQAGLPPGVLNLVTGSASAIGAAITQAPQVRAVSFTGSTAAGEQI
HRSVDMTTRTQMELGGKNPLIVMADADLDRAVDLVVKGGFSLSGQACTGTSRVLVDAPVK
AAFTEKLLAKVKALKVGNSLEGSFDLGPLATARQLESVMRYIEVGKQEARLLYGGERLDG
PGYERGYYLTPAVFADVTQQMRIAREEIFGPVIALIEVNGYEDAIAKANDTEYGLAAAIA
TTNAQYAHRFARDIQAGTVKINRTTTGNLINAPFGGLKRSSTSTFRESGRIGLEFYTQIK
TVYRAG
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
gtggaagatctccggaaccacgagttcaagaactatatcggcgggcaatgggtcgcctgc
gccgcgggcaagacctatcccaacgtaaacccggccgacaccgacgacatcgtggggcgc
ttccaggcctcgcaggccgaggatgcggccgcggcggtggccgccgcgcaggccgccttc
gacggttggcgcaacctggccgtgtccaagcgcgccgcgctgatgcagcgcgccgccgac
tacctggaggcgcacgccgagcagttcggccgcgagctgacgcgcgaggaaggcaaggcg
ctgaacctggccaaggacgaagtcctgcgctcggcgcagaccatccgcttctacgcggcc
gagggccagtcgttcagcggcgaaacctttgtcaacgacgatccggacatggtcgtgtac
agccagcgcgagccgctgggcgtggtgacggtgatctcgccgtggaacttcccggtgtcg
atcccggcgcgcaagatcgccccggcgctgatcaccggcaataccgtggtgttcaagcct
tcctcggatgcgccgctgtccggcctgcgcctggtcgaggcgttcgagcaggcgggcctg
ccgcccggggtgctgaacctggtgaccggcagcgcctcggccatcggcgcggcgatcacc
caggcgccgcaggtgcgcgcggtgtcgttcaccggctcgaccgcggcgggcgagcagatc
caccgctcggtggacatgaccacccgcacgcaaatggagctgggcggcaagaacccgctg
atcgtcatggccgatgccgacctggaccgcgccgtggacctggtcgtcaagggcggtttt
tcgctcagcggccaggcctgcacgggaaccagccgcgtgctggtggacgcgccggtcaag
gcggccttcaccgagaagctgctggccaaggtcaaggccctgaaagtgggcaacagcctg
gaaggcagtttcgacctgggtccgctggccaccgccaggcagctcgaatcggtgatgcgc
tacatcgaggtgggcaagcaggaggcccggctgctgtatggcggcgagcggctggacggt
ccgggctacgaacgcggctactacctcactccggcggtctttgccgacgtcacgcagcag
atgcgcatcgcccgcgaggagatcttcgggccggtcatcgcgctgatcgaggtcaatggc
tatgaagacgccatcgccaaggccaacgacaccgagtacggcctggccgcggccatcgcc
accaccaatgcgcagtacgcgcaccgtttcgcgcgcgatatccaggccggcacggtgaag
atcaaccgcaccaccacgggcaacctgatcaatgcgccgttcggcggcctgaagcgctcc
agcacctcgacgttccgcgagtcgggccgcatcgggctggagttctatacccagatcaag
acggtctaccgcgccggctga

DBGET integrated database retrieval system