KEGG   Bordetella parapertussis Bpp5: BN117_2609Help
Entry
BN117_2609        CDS       T02297                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K05343  
maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN117_2609
Enzymes [BR:bpar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BN117_2609
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     BN117_2609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2799071..2802412
Genome map
AA seq 1113 aa AA seqDB search
MPATHPAPDPLWYKDAVIYQLHVKSFFDANDDGVGDFAGLLAKLDYIVELGVNTIWLLPF
YPSPRRDDGYDIADYRGVHPDYGSLADARRLVRAAHARGLRVITELVINHTSDQHPWFQR
ARAARPGSAHRAYYVWSDDDKAYAGTRIIFCDTEKSNWTWDPVAGAYFWHRFYSHQPDLN
YDNPQVLREVLGAMRYWLDMGVDGLRLDAVPYLVEREGTNNENLPETHAILRRIRRVIDS
EHPGRMLLAEANQWPEDAQEYFGAGDECHMAFHFPLMPRMYMAIAQEDRLPVTDIIRQTP
SIAPQCQWAIFLRNHDELTLEMVTSRERDYLWNVYAAEPRARINLGIRRRLAPLLERDRR
RIELMNSLLLSMPGTPVLYYGDELGMGDNIHLGDRDGVRTPMQWSPDRNGGFSRADPERL
PLPLLMGPLYGYEAVNVEAQQRDPHSLLNWTRRMLAKRRQSHVFGRGELSFLYPGNRKIL
AYLRTWEDTVVLCVANLSQAAQPVELHLSEYAGRVPVEMLGGTAFPQIGELPYLLTLPPF
GFYWLDLSAGAAPPAWHSELPPQMPESITLVSRGAGAALRLTEASRRQLEADVLPAYLQR
QRWYAARRKPGVMRLAYSVPLNDDVESYYEAEIEVSDDGPPRRFHTPVALAWQDDTAAQY
PLARVRRDAQLGTLTDASLQPGYARVLLAALTAGRDIQAGRDIQAGRDIQAGGEPAVRLR
FLPEPGLADLALRDDSKVRALSADQSNSSLLVGERVVFKLLRELHASPHPEAEMTRYLTQ
AGYAHTPALLGEVVRVQGDQAPHTLALAHAYVVNEGDAWNWTVAYLKRTVDAAMLTGASA
DDYQQELAGYEVLAGTIGQRLAQMHSVLARAGELPGFAPRPASERDAALAGEHAVAQLDR
ALQALRACESGLAPASHACAQWLFEHRDRLAAHIMTLAQAETGALRIRVHGDFHLGQILV
AQTDAYLIDFEGEPARPMAERRQLSSPFKDVAGILRSFDYAVAELSRDDPLGGAPRDFNT
GVAEPADPASAPRETREALLASYGNAIDSVLALPPERAQALTCLYLLEKAAYEICYESAY
RPERLPVPIHGLAETARAALLAAAVDHDEGPAP
NT seq 3342 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccacccatcccgctcccgacccgctctggtacaaggacgccgtcatctaccag
ttgcacgtcaagtccttcttcgacgccaacgacgacggcgtgggcgacttcgccggcctg
ctggccaagctggactacatcgtcgagctgggcgtcaataccatctggctgctgccgttc
tatccgtcgccgcgccgcgacgacggctacgacatcgccgactatcgcggggtgcacccc
gactatggctcgctggccgacgcccggcggctggtgcgggcggcccacgcgcgcggcctg
cgcgtcatcaccgagctggtcatcaaccacacctccgaccagcacccttggttccagcgc
gcccgcgccgcgcggccgggttcggcgcaccgcgcctattacgtctggtcggacgacgac
aaggcctatgccggcacgcgcatcatcttctgcgacacggaaaagtccaactggacctgg
gacccggtggccggcgcctatttctggcaccgcttctattcgcaccagcccgacctgaac
tacgacaatccgcaggtgctgcgcgaagtgctgggcgcgatgcgctactggctggacatg
ggcgtggacggcctgcgcctggacgcggtgccctacctagtcgagcgggaaggcaccaac
aacgagaacctgccggaaacccacgccatcctgcggcgcatccgccgcgtcatcgacagc
gagcatcccggcaggatgctgctggccgaggccaaccagtggcccgaggacgcgcaagag
tacttcggcgccggcgacgaatgccacatggcgttccactttcccctgatgccgcgcatg
tacatggccatcgcgcaggaggaccgcctgcccgtcaccgacatcatccgccagacgccg
tccatcgcgccgcaatgccaatgggccattttcctgcgcaaccacgacgagctgaccctg
gagatggtgaccagccgcgaacgcgactacctgtggaacgtctacgcggccgagccgcgc
gcgcgcatcaacctgggcatccggcgccgcctggcgccgctgctcgagcgcgaccggcgc
cgcatcgaactgatgaacagcctgctgctgtccatgccgggcacgcccgtgctgtactac
ggcgacgagctgggcatgggcgacaacatccacctgggcgaccgcgacggcgtgcgcacg
cccatgcaatggtcgcccgaccgcaacggcggcttctcgcgcgccgaccccgagcgcctg
ccgctgccgctgctgatggggccgctgtacggctacgaggcggtcaacgtggaggcgcag
cagcgcgacccgcattcgctgctgaactggacccgccgcatgctggccaagcgccgccag
agccatgtgttcggccgtggcgaactgtcgttcctgtatccgggcaaccgcaagatcctg
gcctatctgcgcacctgggaagacacggtggtgctgtgcgtggccaacctttcgcaggcg
gcccagccggtcgaactgcacctgtccgagtacgccggccgcgtaccggtggaaatgctg
ggcggcaccgcctttccgcagatcggcgagctgccctatctgctgacgctgccgcctttc
ggcttctactggctggacctgagcgccggcgccgcgccgcccgcgtggcacagcgagctg
ccgccgcaaatgccggaatcgatcaccctggtgtcgcgcggcgcgggcgcggcgctgcgc
ctgaccgaggcatcgcgccgccagctggaagcggacgtgctgccggcctacctgcagcgg
cagcgctggtatgccgcgcgccgcaaacccggcgtcatgcggctggcctacagcgtgccg
ctgaacgacgacgtggaaagctattacgaagccgagatcgaagtcagcgacgacggaccg
ccgcgccgcttccatacgccggtggcgctggcctggcaggacgataccgccgcccagtat
ccgctggcgcgcgtgcggcgcgacgcgcagctgggcacgctcaccgacgcctcgctgcag
cctggctatgcgcgcgtgctgctggcggccctgacggccggccgcgatatccaggccggc
cgcgatatccaggccggccgcgatatccaggccggcggcgagcccgccgtgcggctgcgc
ttcctgcccgagccgggcctggccgacctggcgctgcgcgatgacagcaaggtgcgcgcg
ctcagcgccgaccagtccaacagttcgctgctggtcggcgagcgcgtcgtgttcaagctg
ctgcgcgagctgcatgccagcccgcaccccgaagccgagatgacgcgctacctcacccag
gccggctacgcgcatacgccggcgctgctgggcgaggtcgtgcgcgtgcagggcgaccag
gcgccccatacgctggcgctggcccacgcctacgtcgtcaacgaaggcgatgcgtggaac
tggaccgtggcctacctgaagcgcacggtcgacgccgccatgctgaccggcgccagcgcc
gacgactaccagcaggaactggccggctacgaagtgctggccggcaccatcgggcaacgc
ctggctcagatgcactcggtgctggcgcgtgccggcgaactgccgggcttcgcgccgcgg
ccggccagcgagcgcgacgccgccctggcgggcgagcacgcggtggcgcagctggaccgc
gcgctgcaggccttgcgggcgtgcgagagcgggctcgcccctgcatcgcacgcctgcgcg
caatggctgttcgagcatcgcgaccggctggcggcccacatcatgacactggcgcaggcc
gaaaccggcgcgctgcgcatccgcgtgcacggcgacttccatctcggccagatcctggtc
gcgcagaccgacgcctacctgatcgatttcgagggcgagccggcccggcccatggccgag
cgccggcaactgagcagcccgttcaaggacgttgccggcatcctgcgctcgttcgactat
gcggtggccgaactcagccgcgacgatccgctgggcggcgcgccgcgcgacttcaacacc
ggcgtggccgagccggccgacccggccagcgcgccccgggaaacgcgcgaggcgctgctg
gccagctatggtaatgccatcgactccgtgctggccttgccgcccgagcgtgcccaggcg
cttacctgcctgtacctgctggagaaggccgcctacgaaatctgctacgagtcggcctac
cggcccgagcgcctgccggtgcccatccatggcctggccgaaaccgcccgcgccgcgctg
ctggcggccgccgtcgaccacgatgaaggaccggcgccatga

DBGET integrated database retrieval system