KEGG   Bordetella parapertussis Bpp5: BN117_2795Help
Entry
BN117_2795        CDS       T02297                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BN117_2795
Enzymes [BR:bpar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BN117_2795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3018928..3020532
Genome map
AA seq 534 aa AA seqDB search
MTAPTLAPIDPPARAQLLADLQGAPDWDVIVIGGGATGLGTAVDAAARGYRTLLVEAADF
AKGTSSKATKLVHGGVRYLAQGNISLVREALHERGLLNRNAPHLVWPLGFVVPAYSLLDQ
PFYGVGLKMYDMLAGKLNLAPSRWLSRGKTLRHAATVAERVNGRALRGGILYYDGQFDDA
RLAIALMRTLYDLGGVALNYARAVGLTRTDGRVNGVTVADALGELRVTLRAKCVVNATGV
WVDAVRRMDDPAAQTMVVPSQGVHLTLPRDFLPGEDAILIPKTDDGRVLFVVPWNGHTIV
GTTDTPRTDLPLDPQAGQNEIDFILATAARYLSRKPTRADVTSVWAGLRPLVKATGEAST
KSLSREHTIVVSKGGLVTVTGGKWTTYRKMAQDVVDTAIQHKLLAAAPCRTSELPLHGAP
TDGQPNGAPHGTPDSYYGTDLATLRALPGADRMLVKASALTEAHVRYAARHELARTVEDV
LARRNRALFLDAEAALLAAPEVARILAQELGHDEAWSRATLAEFEAVAAHYRLA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccctaccctcgctcccatcgacccgcccgcgcgcgcgcaactgcttgccgac
ctgcaaggcgcccccgattgggatgtcatcgtcatcggcggcggcgccaccggcctgggc
accgccgtcgatgccgccgcgcgcggctaccgcaccctgctggtcgaggccgccgacttc
gccaagggcacctccagcaaggccaccaagctggtgcacggcggcgtgcgctacctggcg
cagggcaatatcagcctggtgcgcgaggccctgcacgaacgcggcctgctcaaccgcaac
gcgccgcacctggtgtggccgctgggcttcgtcgtgccggcctacagcctgctggaccag
ccgttctacggcgtcggcctgaagatgtacgacatgctggccggcaagctgaacctggcg
cccagccgctggctgtcgcgcggcaaaacgctgcgccacgccgccaccgtggccgagcgc
gtcaatggacgagccttgcgcggcggcatcctgtactacgacggccagttcgacgacgcg
cgcctggccatcgccctgatgcgcaccctgtacgacctgggcggcgtggcgctgaactat
gcgcgcgcggtcggcctgacgcgcacggacggccgcgtcaacggcgtgacggtggccgac
gcgctgggcgagctgcgcgtgacgctgcgcgccaaatgcgtggtcaacgccaccggcgtg
tgggtcgacgcggtgcgccgcatggacgaccccgccgcgcagaccatggtggtgcccagc
cagggcgtgcacctgacgctgccgcgcgacttcctgcccggcgaagacgccattctcata
cccaagaccgacgacggccgagtgctgttcgtggtgccctggaacggccacaccatcgtc
ggcaccaccgacacgccacgcaccgacctgccgctcgatccgcaggccggccagaacgaa
atcgacttcatccttgccaccgcagcgcgctacctgagccgcaagcccacccgcgccgac
gtgaccagcgtgtgggccggcctgcgcccgctggtcaaggccaccggcgaagcctcgacc
aagtcgctgtcgcgcgaacacaccatcgtggtctccaagggcgggctggtcacggtcacc
ggcggcaaatggaccacctaccgcaagatggcccaggatgtggtcgacaccgccatccag
cacaagctgctagccgcggcgccatgccgcacgtccgagctgccgctgcatggcgcgccg
accgacgggcagcccaacggcgcgccccacggcacgcccgacagctactacggcaccgac
ctggcgacgctgcgcgcgctgcctggcgccgaccgcatgctggtcaaggccagcgccctg
accgaggcgcacgtgcgctatgccgcccgccacgaactcgcgcgcaccgtggaggacgtg
ctggcccgccgcaatcgcgccctgttcctggacgccgaggccgccctgctggccgcgccc
gaagtggcccgcatcctggcgcaggaactcggccacgacgaagcctggagccgcgccacg
ctggccgagttcgaggccgtggccgcgcactaccggctggcctga

DBGET integrated database retrieval system