KEGG   Bordetella parapertussis Bpp5: BN117_4243Help
Entry
BN117_4243        CDS       T02297                                 

Definition
(RefSeq) aldehyde dehydrogenase
  KO
K22187  
alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BN117_4243
Enzymes [BR:bpar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BN117_4243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4553147..4554607)
Genome map
AA seq 486 aa AA seqDB search
MEDLRNHEFKNYIGGQWVACAAGKTYPNVNPADTDDIVGRFQASQAEDAAAAVAAAQAAF
DGWRNLAVSKRAALMQRAADYLEAHAEQFGRELTREEGKALNLAKDEVLRSAQTIRFYAA
EGQSFSGETFVNDDPDMVVYSQREPLGVVTVISPWNFPVSIPARKIAPALITGNTVVFKP
SSDAPLSGLRLVEAFEQAGLPPGVLNLVTGSASAIGAAITQAPQVRAVSFTGSTAAGEQI
HRSVDMTTRTQMELGGKNPLIVMADADLDRAVDLVVKGGFSLSGQACTGTSRVLVDAPVK
AAFTEKLLAKVKALKVGNSLEGSFDLGPLATARQLESVMRYIEVSKQEARLLYGGERLDG
PGYERGYYLTPAVFADVTQQMRIAREEIFGPVIALIEVNGYEDAIAKANDTEYGLAAAIA
TTNAQYAHRFARDIQAGTVKINRTTTGNLINAPFGGLKRSSTSTFRESGRIGLEFYTQIK
TVYRAG
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
gtggaagatctccggaaccacgagttcaagaactatatcggcgggcaatgggtcgcctgc
gccgcgggcaagacctatcccaacgtaaacccggccgacaccgacgacatcgtggggcgc
ttccaggcctcgcaggccgaggatgcggccgcggcggtggccgccgcgcaggccgccttc
gacggttggcgcaacctggccgtgtccaagcgcgccgcgttgatgcagcgcgccgccgac
tacctggaggcgcacgccgagcagttcggccgcgagctgacgcgcgaggaaggcaaggcg
ctgaacctggccaaggacgaagtcctgcgctcggcgcagaccatccgcttctacgcggcc
gagggccagtcgttcagcggcgagaccttcgtcaacgacgatccggacatggtcgtgtac
agccagcgcgagccgctgggcgtggtgacggtgatctcgccgtggaacttcccggtgtcg
atcccggcgcgcaagatcgccccggcgctgatcaccggcaataccgtggtgttcaagcct
tcctcggatgcgccgctgtccggcctgcgcctggtcgaggcgttcgagcaggcgggcctg
ccgcccggggtgctgaacctggtgaccggcagcgcctcggccatcggcgcggcgatcacc
caggcgccgcaggtgcgcgcggtgtcgttcaccggctcgaccgcggcgggcgagcagatc
caccgctcggtggacatgaccacccgcacgcaaatggagctgggcggcaagaacccgctg
atcgtcatggccgatgccgacctggaccgcgccgtggacctggtcgtcaagggcggtttt
tcgctcagcggccaggcctgcacgggaaccagccgcgtgctggtggacgcgccggtcaag
gcggccttcaccgagaagctgctggccaaggtcaaggccctgaaagtgggcaacagcctg
gaaggcagtttcgacctgggtccgctggccaccgccaggcagctcgaatcggtgatgcgc
tacatcgaggtgagcaagcaggaggcccggctgctgtatggcggcgagcggctggacggt
ccgggctacgaacgcggctactacctcaccccggcggtctttgccgacgtcacgcagcag
atgcgcatcgcccgcgaggagatcttcgggccggtcatcgcgctgatcgaggtcaatggc
tatgaagacgccatcgccaaggccaacgacaccgagtacggcctggccgcggccatcgcc
accaccaatgcgcagtacgcgcaccgtttcgcgcgcgatatccaggccggcacggtgaag
atcaaccgcaccaccacgggcaacctgatcaatgcgccgttcggcggcctgaagcgctcc
agcacctcgacgttccgcgagtcgggccgcatcgggctggagttctatacccagatcaag
acggtctaccgcgccggctga

DBGET integrated database retrieval system