KEGG   Butyrivibrio proteoclasticus: bpr_I1087Help
Entry
bpr_I1087         CDS       T01292                                 

Gene name
amy13A
Definition
(GenBank) alpha-amylase Amy13A
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bpb  Butyrivibrio proteoclasticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    bpr_I1087 (amy13A)
Enzymes [BR:bpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     bpr_I1087 (amy13A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:1335031..1338819
Genome map
AA seq 1262 aa AA seqDB search
MKRGKLWGRLVSAAGLSLSIFLSSIGNVSTAYAMESNDALVLDETKENTESATDASSNEA
SDAEADNDTDEAITDASSKELSAENDGASESDSSFDEYDHTALPETDEITVTAAGELSTA
KAELYTLAPREAREADNSLVTRDSIHDGAILHAFCWSFNTIADNMADIADAGYTAVQTSP
INECLSTNPGMNLHGPDGMWYYHYQPTDWVIGNYQLGSRDEFKHMCDVADEYGVAVIVDI
LPNHTTPSTGNIAKALKEAAGGSEALYHTTGKIGGGYTDRLELTYYSMGGLPDVDTENTG
FQQYFYEFLKDCVYLGADGFRIDTAKHISLPDDPVPSDYSDAGRNTFYPNMREALNDYSE
EVGTKSYDELFVYGEVLQGTNDRLAAYQQYIGGTTASNYGSSLRSALSSGNLSVNRLLDY
QIYDDTAYGSTYTADTEKLVTWVESHDNYMNDSESCWKSIDDDMVIMGWSIIAARDAGTP
LFFSRPNNSSAENPYGDNLIGAAGSPIYKAPEVKAVNLFREKMGEADEYLSNPGGNIQTL
MIERYNDTVQGAVIVNAAQTRTTISTETHLSDGIYPDQVEGSNAVFLVKDGVLSGSVEGE
GVVVLSEKIDGTGKVISFYNNKNWNGVVARVDNAEETLDTIDENDGWFQVTVLDDEFTIR
FESADGKEVSPEFQITAESGTFATPDSSELYYSKAETEEGLGIHTYPVYFFNTENWGSVY
TYGWLDGGAQLFGGWPGTVAVNEGSGWYRADVKTTGEITAFNLIFNNGNGIQTVNVEGIT
PDSKDIYLAVDAEKSNGQLIVNRYEDKESAEKALGVSGSYTTAYFYNTEGWDKVCAYTWG
ATALGDWPGKELTQDEDGWYSVVLPAGPSEDLNIIFNNGNNGKQTNDMKISDMKYRFILN
NGISYQKYGSKKDAMEAIAGAGDVTYETVYFYNEKADDANWKNVYLYVFGGTDGEYNNLV
GTWPGKLMEKEEDSNWLRAEVPSKALESGTLTYIFNNGNGTQLDDNKNITSTKNYFTFSS
RDSFASKEEVYSFLGISTDDPSAPEEPQEPEATLTKKYSKYYLVTEDGEKLTGFHEVDGI
LRYFAENTGVMAINKWVTVEDKKYRALDEGRIASNEIIREYGSDYYLGEDGVLVTGLFDY
NGDKYYAKSNGKIVKSGLLEIDGEYYIPDSDGRLMHDVKTAIYFSEYILGSDCKAVKGFT
TYEGQRYYGKANGRVAKDYMFTVDGDTYYAKNDGTLAVSETITRFFKKYTFDENGKLISV
GK
NT seq 3789 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggggaaaattgtggggcagattagtatctgcggcaggccttagcttgtctatt
tttttgagttcgattggaaacgtttccactgcatacgcgatggaaagtaatgatgcattg
gtccttgatgagaccaaagagaacactgaaagtgctactgatgcatcatctaatgaagcg
tcagatgcagaagcagataatgacacagatgaagcgataacagatgcttcaagcaaggaa
ctttcagctgaaaatgatggagcttcagaatcagacagttcttttgatgaatatgatcat
actgctttgccagaaactgatgagataacagtaactgcggctggagaactttctactgca
aaggctgagctttatacactggcaccaagagaggccagggaagcagataacagccttgtt
acaagagatagtattcatgatggagcaatccttcatgcattttgctggagctttaatact
atagctgataatatggcagatattgcagatgccggatatacagctgttcagacatctccg
atcaatgaatgtctttcaactaatcccggtatgaatctgcatggccctgatggaatgtgg
tattaccactatcagccaacagactgggttattggtaactatcagctcggaagccgtgat
gaattcaagcacatgtgcgatgttgccgatgagtatggagttgctgttattgtagatatc
cttccaaaccatacaactccatctacaggtaatattgccaaagctcttaaggaagctgca
ggcggaagcgaggctctttaccacacaacaggtaagataggcggtggatatacagacaga
ttagagcttacttactattctatgggcggacttcctgacgtggatacagagaatacagga
ttccaacagtacttctatgaattccttaaagactgcgtatatctcggcgcagatggattc
agaattgatactgccaagcacatttcacttcctgatgatcctgttccttctgattattca
gacgctggcagaaacactttttatccaaacatgagagaggctcttaatgattactcagaa
gaagtaggaacaaagagctacgatgaactctttgtctatggagaagtgcttcagggaaca
aatgacagacttgcagcatatcagcagtatattggcggaacaactgccagcaactatggc
tcaagccttagatctgctctttcaagcggaaatctttctgtaaacagacttttggattat
cagatttatgatgatacagcttatgggtcaacttatactgcagatacagaaaagcttgtt
acctgggttgagtctcatgacaactacatgaacgattctgagagctgctggaagtctatt
gatgacgatatggtcatcatgggctggtcaattatcgcagcaagagatgcaggaacacct
ttgttctttagcagacctaacaacagctctgcagaaaatccatatggcgataaccttatt
ggtgcagcaggaagccctatctataaggcacctgaagtcaaggcggttaatcttttccgt
gaaaagatgggcgaagctgatgaatatctttcaaatccgggcggcaatatacagacactt
atgattgaaagatataacgatacagttcagggagctgtaatcgtaaatgcagcacagacc
agaacaactatcagcacagagacacacttatcagatggcatctatcctgatcaggttgaa
ggaagcaacgcagtatttcttgtaaaggatggtgtgctcagcggatctgttgagggcgag
ggagtagtagttctgtctgaaaaaatagatggaacaggtaaggttatttctttctacaac
aataagaactggaatggtgttgtagcaagagttgataatgcagaagaaacacttgataca
attgatgaaaatgatggatggttccaggtaactgttcttgatgatgagttcaccataaga
tttgagagcgcagatggaaaagaggtttctccagagtttcagattacagcagaaagcgga
acatttgctactcctgacagctcagagctttactattctaaggctgaaactgaagaagga
cttggaattcatacatatcctgtatatttctttaacactgaaaactggggcagcgtatat
acatacggatggcttgacggaggagcacagctctttggcggatggccgggaacagttgct
gtaaatgaaggttcaggctggtatagagcagatgttaagactaccggtgagattacagca
tttaatcttatctttaataatggaaacggtattcagactgtaaatgtagagggcataaca
ccggatagcaaggatatttatcttgcggtagatgcagaaaaatcaaatggtcagcttatt
gtaaacagatatgaagataaggaatctgcagagaaggcacttggggtatccggatcatat
acaacagcttatttctataacacagaaggctgggacaaagtttgcgcatatacctgggga
gcaacagctcttggagactggccgggtaaagaactgactcaggatgaggatggctggtac
agcgtagttcttcctgcaggcccaagcgaagaccttaacatcatctttaacaacggcaac
aatggcaaacagacaaatgacatgaagatttctgatatgaaatacagatttatcctgaat
aatggtatttcctatcagaaatatggctccaaaaaggatgctatggaagctattgccggt
gctggcgatgttacatatgagacagtatacttctacaacgaaaaagctgatgatgcaaac
tggaagaatgtatatctttatgtatttggcggaacagatggcgaatacaataatcttgta
ggcacatggcctggtaagctcatggaaaaggaagaggacagcaactggttaagagcagag
gttccttccaaagctcttgaaagcggaactcttacatatatctttaacaatggaaatggt
acgcagcttgatgataacaagaatatcacaagcacaaagaactatttcacatttagtagc
agagacagctttgcaagtaaggaagaggtttattcattccttggtatatctacagatgat
ccttctgctccggaagagcctcaggagcctgaagctactcttaccaagaagtatagcaaa
tactatcttgtaacagaagatggtgagaagcttacaggattccacgaagttgacggtatt
ctcagatactttgctgaaaatactggtgtaatggctataaacaagtgggttactgtagaa
gataaaaagtacagagctcttgatgaaggcaggatcgcaagtaatgaaataatcagagaa
tacggctcagattattatcttggcgaagatggagtgcttgtgacaggtcttttcgattac
aatggtgataagtactatgcaaagtctaatggtaagattgtaaagagcggacttctggaa
atagacggagaatactatattcctgattcagatggaaggctcatgcatgacgttaagact
gcaatatacttctcagagtatatcttaggttctgattgcaaggctgttaagggctttaca
acctatgagggacagagatattacggcaaagctaacggaagagttgccaaggattatatg
ttcacagtagacggtgatacatattatgccaagaatgatggaacacttgctgtatctgag
acaattacaagattcttcaagaaatacacatttgatgaaaacggcaagcttattagcgta
ggaaaataa

DBGET integrated database retrieval system