KEGG   Burkholderia pseudomallei 668: BURPS668_1318Help
Entry
BURPS668_1318     CDS       T00481                                 

Definition
(GenBank) glutathione S-transferase family protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bpd  Burkholderia pseudomallei 668
Pathway
bpd00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bpd00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BURPS668_1318
Enzymes [BR:bpd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BURPS668_1318
Transporters [BR:bpd02000]
 Other Transporters
  Pores ion channels [TC:1]
   BURPS668_1318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_C_2 GST_N_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ABN84464
UniProt: A3N7P5
LinkDB All DBs
Position
I:1286108..1286764
Genome map
AA seq 218 aa AA seqDB search
MLRLCGFPVSNYYNKVKFVLLEHDIPFEAPIVSVPIKDPAFLADTPLGKVPYLMTEHGSL
CESQAIIEYLAAIHPDKPIFPADPFAAAKAREITAVLELYLEWNVRELFPEAFFGGKVSD
GTKAHVEKRMPRALDGFKRLAKFSPYVLGDTFCIADIAAFIHLPVVALATKAIYGRDFVV
DAGIDWKAYVKRIEEARPAAKRVSDERKAFVAGLAKPG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggctttgtggctttccagtgtccaattattacaacaaggtcaagttcgtcctg
ctcgagcacgacattccgttcgaagcgccgatcgtcagcgtcccgatcaaggaccccgca
tttttggccgatacgccgctcggcaaggtgccgtatctgatgaccgagcacggctcgctg
tgcgaatcgcaggcgatcatcgaatatcttgccgcgattcatcccgacaagcccattttc
ccggccgatccgttcgcggcggcgaaggcgcgcgagatcacggcggtgctcgagctgtac
ctcgaatggaacgtgcgcgaactgtttccagaggcgttcttcggcggcaaggtgagcgac
ggcacgaaggcgcacgtcgagaagcgcatgccgcgcgcgctggacggtttcaagcggctc
gcgaaattttcgccgtacgtgctcggcgatacgttctgcattgccgacatcgccgcgttc
atccatctgccggtcgtcgcgctcgcgacgaaggcgatctacggccgcgatttcgtcgtc
gacgcggggatcgactggaaggcgtacgtgaagcgcatcgaggaagcgcggccggccgcg
aagcgcgtgagcgacgagcgcaaggcgttcgtcgcggggctcgcgaagccgggctga

DBGET integrated database retrieval system