KEGG   Burkholderia pseudomallei 668: BURPS668_A1800Help
Entry
BURPS668_A1800    CDS       T00481                                 

Definition
(GenBank) AMP-binding domain protein
Organism
bpd  Burkholderia pseudomallei 668
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
II:complement(1759787..1761619)
Genome map
AA seq 610 aa AA seqDB search
MRRVQITDGAIVPSNFAEHFENQVLKYGNRSQFVFLHGKPGDSAGEARLGYAQLDARARS
IAAWLSACGAACRPVLLVYPEGLAFVAAFLGCLYAGAIAVPVPVPADARSVERIRRIVRD
AGIALALTPTAADAHALANCLAAPGDAVSTVGALRCEATDALEPLDASAWSRPALDASAI
AFLQYTSGSTGEPKGVVVSHRNLLHNEAQIQRVVASDADSVVTGWLPHFHDMGLIGMLLH
PLYVGCDCVFMAPSTFLRRPVRWLEAATHYAATITVAPNFAYDLCARAVKREQLGGLDLS
ALKVALNGAEPVRAKTIEAFSARFAPVGFDARAFSPCYGMAEVTLLASAGRPAAAPVLLD
IDARALERHEASLAKPGAEALRVVGSGRAVDLDLRIVDPQTRAVAADGRIGEIWLRGDSV
AQGYWRRPDASEAAFRARTAAGDGPYLRTGDLGFVRDGELFVTGRLKDLLIVNGRNLYPQ
DIEDFVRELHPALGAGAGAAFSIDADGERVVVVHEIKEARLDDGLSAAALSARIRTALAR
AFDIAAPSVVLVPRGGVKRTTSGKVQRGLTRDAFLAARLRVLHEDIQVPVRSLRVAAGEG
VAQDASRGAA
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgtgtacaaattactgatggagcaatcgtgccgtctaattttgccgaacacttc
gaaaatcaagtcttgaagtacgggaatcgcagtcaatttgtttttctacacggaaaaccc
ggtgattcggccggcgaggcgcggctcggctatgcgcaactggatgcccgcgcgcggtcg
atcgccgcgtggctgtcggcgtgcggcgccgcgtgccggccggttctgctcgtctatccc
gaaggcctcgcgtttgtggcggcttttctcggctgcctgtatgccggcgcgatcgccgtg
ccggtgcccgtgcccgcggacgcgcgcagcgtcgaacgaatcaggcggatcgtccgcgat
gcgggcatcgcgcttgcgctgacgccgacggccgccgatgcgcacgcgctcgcgaactgc
ctggccgcgcccggcgatgcggtctccacggtcggcgcgctgcgatgcgaggccaccgac
gcgctcgagcccctcgatgcgagcgcgtggagcaggccggcgctcgatgcctcggcgatc
gcgttcttgcaatacacgtccggctcgacgggagagcccaaaggcgtcgtcgtgtcgcat
cgtaatctgctgcacaacgaagcgcagattcagcgtgtcgtggcgagcgacgccgatagc
gtcgtgacgggatggctgccgcattttcacgacatggggctgatcggcatgctgctgcat
ccgctgtacgtcggctgcgactgcgtgttcatggcgccgtccacgttcttgcggcgtccc
gttcgatggctggaggccgcgacgcattacgcggccacgattacggttgcgccgaacttc
gcgtacgacctgtgcgcgcgcgccgtgaagcgcgagcaactcggcgggctcgatctgtcc
gcgctgaaggtcgcgttgaacggcgcggagccggttcgcgcgaaaacgatcgaagcgttc
tcggcgcgtttcgcgccggtcggcttcgatgcacgggcgttttcgccgtgctacgggatg
gccgaggtcacgttgctcgcgagcgcgggccgcccggcggcggcgcccgtgctgctcgat
atcgacgcgcgggcgctcgagcgccatgaggcatcgttggcgaagcccggtgccgaggcg
ttgcgcgtcgtcggcagtgggcgcgccgtcgatctcgatctgcgcatcgtcgatccgcaa
acgcgcgccgtggcggccgacgggcgcatcggcgagatctggctgcgcggcgacagcgtc
gcgcaaggctactggcgccgccccgacgcgagcgaggcggcgttccgggcgcgcacggcc
gcaggcgacgggccgtatctgcggaccggcgatctcggtttcgtgcgggacggggagctg
ttcgtgaccgggcgcctcaaggacctgctgatcgtcaacggccgcaacctctatccgcag
gacatcgaggatttcgttcgcgagttgcatcccgcgctcggcgcgggcgcgggcgcggcg
ttttcgatcgatgcggacggcgaacgcgtcgtcgtcgtccatgaaatcaaggaggcgcgg
ctcgacgatggcctttcggccgccgcgctgtccgctcgcatcaggacggcgctcgcgcgt
gcgttcgacatcgcggccccgagcgtcgtgctcgtgccgcgcggcggcgtgaagcgcacg
acgagcggcaaggtgcagcgcggcctcacgcgcgacgcgtttctggccgcgcggctgcgc
gtgctgcacgaggatatccaggtgccggttcggtcgttgcgtgtggccgcgggcgagggc
gtcgcgcaggatgcctcccggggcgccgcatga

DBGET integrated database retrieval system