KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110154455Help
Entry
110154455         CDS       T05002                                 

Gene name
hdac6
Definition
(RefSeq) histone deacetylase 6
  KO
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
Enzymes [BR:bpec01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     110154455 (hdac6)
Protein phosphatases and associated proteins [BR:bpec01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110154455 (hdac6)
Messenger RNA biogenesis [BR:bpec03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     110154455 (hdac6)
Membrane trafficking [BR:bpec04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    110154455 (hdac6)
Chromosome [BR:bpec03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     110154455 (hdac6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1050 aa AA seqDB search
MFNDLSSRSAAVGTGLVYSEEFTKHRNLWDTSHPECPERLQKIVEELEKQELLSRCTRIQ
PREATEKELLLIHSQKYVDLMRSTQTMTEAELRSLSEKYDSVYLHPDTFSVAAQAVGSVL
QLVDRVLSSELRNGFALIRPPGHHAQRDQANGYSVFNNVAVAARYAQTKHRIHRVLIVDW
DVHHGQGIQYSFQDDPNVLYFSIHRFEHGSFWPHLSESNSDFTGDTRGAGRNINLPWNKT
GMTDADYIAAFYHLLLPVAYEFQPQLVLVSAGFDSAEGDPKGEMCVSPQCFQVLTRLLMS
LAEGRIILALEGGYNLAQTAVCAAACVKAFLGGACPPLSLPTAPSDSALESISQTISSVY
PYWASLQVLEGCSVSGAEVLRESTNQGSSCCPSPASSVSTKTGLVYDEKMMEHLNMWDRH
HPEQPQRISKIYSRHQQQGLEQRCERLEVRLATEEELLMCHSADHIARMKSTSDLKPRDL
FKLGEEFNSIFLNDQSYECALMAAGGCFRAVEAVLSGQVSNAVAIVRPPGHHAEKSFPCG
FCLFNTAALTARFAQKVSNNPSLRVLILDWDVHHGNGTQHIFEDDDSVLYVSLHRYDNGN
FFPSSLDAACDKVGVARGAGFNVNVAWSGGRMGDADYIAAFHRVVMPIATEFNPDLVLVS
AGFDAARGDPLGGYNVTPEGYAHLTHLLLTLASGKLVMILEGGYNLTSISESMAFCTSVL
LGDPPPSILSPPPHHSAVATINEVIRHHAPFWKSLRIHIPDSVRESLPSPKHRGKCSSKG
KGRKSDQSDKPPLPPSDLEQLTQELAGLDITQTAAVGGARPKLRPSSGKPNNQREEKAES
SEKSQSESQVVAATDSDMPESSPVKREESEFSPVKGEGSEGSPVKGAESQPLPLKGEESE
LSPVKGAESAAKSEAAGACGWSKINLQVSYEVEMGGDTLFVVDPLPWCPHLDSVKPLPPG
GLNVFKPCEDCGSEVENWVCLTCYKVFCGRYVNEHMVIHGVTAEHPVVLSYADLSVWCYL
CESYIHNQILFEAKNAAHWAKFGEEVPPWT
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atgttcaatgacctgtcgagtcgatcagctgctgtaggtactggactagtgtattctgaa
gagttcaccaaacataggaacctctgggacacaagtcacccagaatgtccggagagactg
cagaagattgtggaggagctggaaaaacaggaactgcttagtcgctgcaccagaatccag
ccacgagaggcaacggaaaaagaactgctgctcattcactcgcagaagtatgtggatctg
atgcgctcgacccaaacaatgaccgaggctgaactgagatctctgtcagaaaaatacgac
tccgtttatctccatccggacacattttctgtagcggctcaggctgtgggctccgtcctg
cagctcgtcgacagagtcctctcctctgaactcagaaatggatttgctctgatcagacct
ccaggacaccacgctcagagagaccaggccaacggctacagtgtgtttaataatgtggcc
gtagctgctcgatacgctcagaccaagcacagaatccacagagttctcatcgtggactgg
gatgtgcatcatgggcagggcatccagtatagcttccaggatgaccccaatgttctgtac
ttcagcattcaccgctttgagcacggatcattctggcctcatctttctgagtcaaactcc
gattttacgggagacacaagaggagccggacgaaacatcaacttgccctggaacaagact
ggaatgactgatgcagattacattgctgctttctatcatctcctgcttcctgttgcgtac
gagttccagcctcagttggtcctggtttccgctggttttgattctgcagaaggagaccca
aagggcgagatgtgcgtcagtcctcagtgcttccaggttctaacacgtcttctcatgagt
ttagctgaaggacgcatcattctggctctagagggcggttataacttggcacaaacagca
gtttgcgctgcagcctgtgtgaaagctttcctgggtggagcctgtccccccctgtctcta
cccactgctccctccgacagtgctctggagtctatatctcagaccattagctccgtttat
ccttattgggcttctctccaagtcctggagggatgctcggtctctggtgctgaggtattg
agggaatcgaccaatcagggaagctcgtgttgcccaagtcccgcctcttcagtatccaca
aagactggactggtttatgatgagaagatgatggagcacctcaatatgtgggacagacat
catccagaacaaccacagagaatttcaaagatctactctcgacatcagcagcagggtctg
gagcaacgctgtgagagactcgaggtccgactggcgacagaggaggagctcctgatgtgc
cacagtgcagatcacatcgctcgtatgaagtccacctctgatctgaagcccagagacttg
ttcaaactgggggaggagtttaactcaatcttcctgaatgatcagagttatgagtgtgct
ctgatggcggcaggcggctgtttcagggctgtggaggctgtgctctctggacaggtctct
aatgctgtggccatagtgcgccctcctggacaccacgcagagaagagcttcccctgtggc
ttctgcctcttcaacacagcggctcttacagctcgatttgctcagaaagtttcaaacaat
ccttcattacgggtcctgattctggactgggacgttcaccatggcaacgggacgcaacac
atatttgaagatgacgacagtgtgttgtacgtatcacttcatcgctatgacaatggcaac
ttcttcccctcctcgttggacgctgcgtgtgacaaagtgggcgtggccagaggggcgggc
tttaatgtgaacgtggcctggagtggagggaggatgggcgatgcagactatatcgccgcg
tttcacagagtcgtcatgcccatcgccaccgagttcaacccagatctggtcctggtctcg
gctgggtttgatgcggcgcgtggagatcctttaggaggctacaatgtgactccagaggga
tacgcccacctcactcaccttctgttaactttggcctctgggaaactagtcatgatcctg
gagggagggtacaacttgacgtctatctctgagtccatggccttctgtacttctgtgtta
ctcggagacccgcctccatcgatcctgtccccgcctcctcatcacagcgctgtggcgacc
atcaacgaggtcatcagacaccacgctcccttttggaagtcactgcggatacacatccca
gattcggtgcgcgagtcattgccatccccaaagcatcgtgggaagtgcagttctaaagga
aaaggcaggaagtctgatcagagtgacaaacctccacttcctccctcagacctggagcaa
ctcacgcaagaactggccggattagacatcacgcagactgctgctgtgggcggggccaga
ccaaagctccgccccagctcaggaaaaccaaacaatcagagagaggagaaggcggagtca
tcagaaaagagtcagtcagagtcacaggttgttgctgccactgattcagatatgccagag
tcctcacctgtgaaaagggaggagtctgaattctcacctgtgaaaggggaaggatctgaa
ggctcacctgtgaaaggggcggagtctcaacccttacctctgaaaggggaggagtctgaa
ctgtcacctgtgaaaggggcggagtctgctgccaagtcggaggcagctggagcctgtggt
tggtccaagataaacttacaggtgtcatatgaagtggagatgggcggagacaccttgttt
gtggtggaccctcttccctggtgccctcatctagactctgtcaaaccgctgccccctggt
ggtctgaacgtgttcaaaccctgtgaggactgtggctctgaggtggagaactgggtctgt
ctcacctgctacaaggttttctgcggccgatacgtgaatgagcacatggtgattcatgga
gtcacagcagaacatcctgtggttctgagctacgctgatctgtctgtgtggtgctacctc
tgcgaatcctacatccacaaccagattttatttgaagccaagaatgcagctcactgggca
aaatttggagaagaggttccaccctggacttaa

DBGET integrated database retrieval system