KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110156027Help
Entry
110156027         CDS       T05002                                 

Gene name
suv39h1
Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H1
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:bpec00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    110156027 (suv39h1)
Enzymes [BR:bpec01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     110156027 (suv39h1)
Chromosome [BR:bpec03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110156027 (suv39h1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    110156027 (suv39h1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 411 aa AA seqDB search
MAEYLKECHVPCKMSWEETETLCRLEELYCKDLGVNRTNVHEYEVEFICDYKRTKEEEFY
LVKWRGFAEAENTWEPKSNLKCRKLMKQFHVDLEKELRRHKRRCVPRRLDKEISSLLAKK
AKLRQRLERWQAHLNHTSNHPGRIYVVNDVDLEGPPRNFTYINNYKPGPGIVLDEMAVGC
ECTNCIEDPVDGCCPGASLHRIAYNEKQRLRVRAGEPIYECNSRCRCGPDCPNRVVQRGI
QFDLCIFRTENGRGWGVRTLQHINKNTFVMEYIGEIITNEEAEKRGREYDSQGSTYLFDL
DYVEDVYTVDAAHYGNISHFVNHSCTPNLQVFNVFIDNIDERLPRIALFSTRSICAGEEL
TFDYKMQIDPVDLDSSRLDSSITLTDLPRSPKKRLRVECRCGSDSCRKYLF
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggcggaatatttgaaagagtgccatgtgccctgtaagatgtcctgggaggagacggag
acgctgtgccgcctggaggagctgtactgtaaagacctgggggtgaaccggaccaatgtg
cacgagtatgaagtggagttcatctgcgactacaagaggaccaaggaggaggagttctac
ctggtgaagtggcgagggtttgcggaggcggagaacacgtgggagccaaagtccaacctc
aagtgtcgaaaactgatgaagcagttccacgtggacctggagaaggagctgcgccgccac
aagaggcgctgtgtgccgcgcagactggacaaagagatctcctcgctcctcgccaaaaag
gccaaactccggcagagactggagcgctggcaagcccacctcaaccacaccagcaaccac
cccggccgcatctacgtggtcaacgacgtggacctcgagggaccgcccagaaacttcacc
tacatcaacaactacaagcccggcccgggcatcgtgctggatgagatggccgtgggctgt
gagtgcactaactgtatagaggacccggtggacgggtgctgccctggcgcctctttgcac
cgaatcgcctacaacgagaagcagaggctgcgcgtgcgcgccggggagcccatctacgag
tgtaactcccgctgcaggtgcggccccgactgccccaacagggtggtccagaggggcatc
cagtttgacctgtgcatcttcaggacggagaacgggcgcggctggggcgtccgcacgctc
caacacatcaacaaaaacaccttcgtcatggagtacatcggagagatcatcaccaacgag
gaggcggagaagcgcggccgtgagtacgacagtcagggctccacctacctgtttgacctc
gactacgtggaggacgtgtacacggtggacgccgcgcactacggaaacatctcccacttt
gtcaaccacagttgcactccaaacctgcaggtgtttaacgtcttcatagacaacatcgac
gagcggctgcccaggatcgccctgttctccacacgatccatctgcgccggggaggagctc
accttcgactacaagatgcagattgacccggtggacctggacagcagcaggttggactcg
agtatcacgttgacggacctgccccgctccccaaagaagcgtctcagagtggagtgccgc
tgcggctctgactcgtgccggaagtacctcttctga

DBGET integrated database retrieval system