KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110156027Help
Entry
110156027         CDS       T05002                                 

Gene name
suv39h1
Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H1
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:bpec00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    110156027 (suv39h1)
Enzymes [BR:bpec01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     110156027 (suv39h1)
Chromosome [BR:bpec03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110156027 (suv39h1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    110156027 (suv39h1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 411 aa AA seqDB search
MAEYLKECHVPCKMSWEETETLCRLEELYCKDLGVNRTNVHEYEVEFICDYKRTKEEEFY
LVKWRGFAEAENTWEPKSNLKCRKLMKQFHVDLEKELRRHKRRCVPRRLDKEISSLLAKK
AKLRQRLERWQAHLNHTSNHPGRIYVVNDVDLEGPPRNFTYINNYKPGPGIVLDEMAVGC
ECTNCIEDPVDGCCPGASLHRIAYNEKQRLRVRAGEPIYECNSRCRCGPDCPNRVVQRGI
QFDLCIFRTENGRGWGVRTLQHINKNTFVMEYIGEIITNEEAEKRGREYDSQGSTYLFDL
DYVEDVYTVDAAHYGNISHFVNHSCTPNLQVFNVFIDNIDERLPRIALFSTRSICAGEEL
TFDYKMQIDPVDLDSSRLDSSITLTDLPRSPKKRLRVECRCGSDSCRKYLF
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggcggaatatttgaaagagtgccatgtgccctgtaagatgtcctgggaggagacggag
acgctgtgccgcctggaggagctgtactgtaaagacctgggggtgaaccggaccaatgtg
cacgagtatgaagtggagttcatctgcgactacaagaggaccaaggaggaggagttctac
ctggtgaagtggcgagggtttgcggaggcggagaacacgtgggagccaaagtccaacctc
aagtgtcgaaaactgatgaagcagttccacgtggacctggagaaggagctgcgccgccac
aagaggcgctgtgtgccgcgcagactggacaaagagatctcctcgctcctcgccaaaaag
gccaaactccggcagagactggagcgctggcaagcccacctcaaccacaccagcaaccac
cccggccgcatctacgtggtcaacgacgtggacctcgagggaccgcccagaaacttcacc
tacatcaacaactacaagcccggcccgggcatcgtgctggatgagatggccgtgggctgt
gagtgcactaactgtatagaggacccggtggacgggtgctgccctggcgcctctttgcac
cgaatcgcctacaacgagaagcagaggctgcgcgtgcgcgccggggagcccatctacgag
tgtaactcccgctgcaggtgcggccccgactgccccaacagggtggtccagaggggcatc
cagtttgacctgtgcatcttcaggacggagaacgggcgcggctggggcgtccgcacgctc
caacacatcaacaaaaacaccttcgtcatggagtacatcggagagatcatcaccaacgag
gaggcggagaagcgcggccgtgagtacgacagtcagggctccacctacctgtttgacctc
gactacgtggaggacgtgtacacggtggacgccgcgcactacggaaacatctcccacttt
gtcaaccacagttgcactccaaacctgcaggtgtttaacgtcttcatagacaacatcgac
gagcggctgcccaggatcgccctgttctccacacgatccatctgcgccggggaggagctc
accttcgactacaagatgcagattgacccggtggacctggacagcagcaggttggactcg
agtatcacgttgacggacctgccccgctccccaaagaagcgtctcagagtggagtgccgc
tgcggctctgactcgtgccggaagtacctcttctga

DBGET integrated database retrieval system