KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110156371Help
Entry
110156371         CDS       T05002                                 

Definition
(RefSeq) beta-1,3-galactosyltransferase 4-like
  KO
K00715  
ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpec00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    110156371
Enzymes [BR:bpec01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.62  ganglioside galactosyltransferase
     110156371
Glycosyltransferases [BR:bpec01003]
 Glycan extension
  Glycolipid
   110156371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 381 aa AA seqDB search
MTVCELCRDGALAMLGQICKPRLRKRARKPGVLPYLCLVIATTTVFAVVFFDCIESWVTS
ARMNADLEPHAGIIPLQSVPPTRPEEFLLMPSPLVCQRAKPYIITMVTSAPANQRARQAI
RDTWGGEVEVTGLRVMTLFIVGVPSDPALGKLLIVEARERGDLIQGRFLDTYSNLTLKTL
SMLGWARRFCPQAHFMAKVDDDVLFNPSALLHFLNKSRNPYEHGDLYLGRVHIRVAPNRD
PSSKHYLPTGTYSASVFPDYCSGTTYVLSRSALLKISLAATASALSTPLPPEDIFVGMCA
RAAGVLPSHCPLFSGGPRVPYGRCCYQAMVSVHRVAPRDMLRYWADLHTLPPCSWLSVRA
SLGLCKVRAWLGVALGIKQDV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgacggtctgtgagctgtgtagggacggcgcactggccatgctcggacagatatgtaaa
ccccgtttgagaaagcgagcacgaaaacctggggtactgccttatctgtgccttgtaata
gcgacaacaactgtttttgctgtcgtcttttttgactgcatcgagtcatgggtcacatca
gcgagaatgaacgcagatttggagccacacgcgggcatcatccccctgcagagcgtgcca
ccaacgcgtccggaggagttcttgctcatgcccagccccctcgtgtgccagcgagcaaaa
ccgtacatcattaccatggttacttcagctcctgccaatcaaagggcacgacaggccatc
cgagacacttggggtggtgaggtggaggtaacggggctcagggttatgactctttttatt
gtgggtgtgccgtcggacccagctctgggcaaactgctcatagtggaggccagagagcga
ggggacctaatccagggtcgctttctggacacatactccaatctcaccctgaagaccttg
tccatgctcgggtgggcgcgccgcttctgcccgcaggctcattttatggccaaagtggac
gatgatgttcttttcaaccccagcgccctgctccactttctgaacaaaagcagaaacccc
tatgagcacggggacttgtacctgggcagggttcacattcgtgtggctcccaaccgtgac
cccagcagcaagcactacctcccgacagggacctactctgcctccgtgttcccagactac
tgcagcggaaccacctacgtcctctcgcgctctgcattgctcaaaatctctctggcggcc
acagcttcagccctgtccacacctctcccccctgaagatatatttgtgggcatgtgtgca
cgtgcagctggggtcctgccctcacactgccctcttttctccggtggtcctcgtgttccc
tatggacgatgctgttaccaggccatggtgtcagtccacagggtcgctccaagggacatg
ctgcggtactgggctgacctccacacactccctccctgctcctggctcagtgttcgggct
tctctaggactctgcaaagttagagcctggttaggtgttgcgttaggaataaagcaggat
gtgtaa

DBGET integrated database retrieval system