KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110157007Help
Entry
110157007         CDS       T05002                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:bpec00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    110157007
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110157007
   00982 Drug metabolism - cytochrome P450
    110157007
   00983 Drug metabolism - other enzymes
    110157007
Enzymes [BR:bpec01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     110157007
Transporters [BR:bpec02000]
 Other Transporters
  Pores ion channels [TC:1]
   110157007
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 240 aa AA seqDB search
MVTEKCFAKGSPAPGPVPKGHIRLYSMRFCPFAQRTRLVLNAKGIKYETINIHLKEKPEW
FLERNPLGLVPAIETETGEVVYESPITCDYLDEVYPQNKLLPSTPFGKAKQKMMLEYFSK
VIPCFYKIVTAKKNGEDVSGPVDELTEKFDKMDKSLVKKKTKFFGGDSITMIDYMIWPWF
ERLESFDLKHLLDSTPELKQWYGRMCEDPAVKASAHSTDAHKAFFKSAFIDGKPDYDYGL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggtcacagagaagtgtttcgctaaaggaagtcctgcccctggtccagtgcccaaaggc
cacattagactgtacagcatgaggttctgcccatttgcccaaaggacaaggctggtgctc
aatgctaagggcattaagtatgaaaccattaacatccacctgaaggaaaaaccggaatgg
tttctggagaggaaccctcttggacttgtgcctgctattgagaccgagactggtgaggtg
gtgtacgagtctcccatcacctgtgactacctggatgaggtctacccccagaacaaactg
cttccttcaactccttttggaaaggctaagcagaagatgatgctggagtatttctccaag
gttattccttgtttctacaaaattgttacagcaaagaaaaatggtgaagatgtgtctgga
ccagtcgatgaactgacagaaaagtttgataaaatggataagagtctggttaaaaagaag
accaaattctttggtggtgactccattacaatgattgattacatgatttggccgtggttt
gaaagacttgagtcctttgatctcaaacatctcctggacagtactcctgagctaaaacag
tggtatggccgaatgtgtgaagatcctgcggtcaaagctagtgcacacagcaccgacgcc
cacaaggcatttttcaagtctgcatttattgatggcaaaccagactatgactatggcctg
taa

DBGET integrated database retrieval system