KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110162520Help
Entry
110162520         CDS       T05002                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E-like
  KO
K05622  
transglutaminase 5 [EC:2.3.2.13]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
Enzymes [BR:bpec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     110162520
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 757 aa AA seqDB search
MTTQSPNTNILGVDFKPAQNNPLHHTGALSKHLLIVRRGQSFSMHIQFNHPFISGLHKLI
FTATTGLYPGEDIGTKCVFGLPDLVNRSAKAKAIWSVVMDTRMSYLEMGNLHLTVTPPAN
APVGKYLLFLDEAGEQKELGSLVVLFNPWCPTDWVYMPEEADRQEYVMNTHGIIYKGTGN
YITSMAWDFAQFEEKMVQICLMLLDLSHKHLKDPADDVSARCNPIYVSRIISAMINSEDD
RGVLMGRWGDNFTGGTPPSHWSGSYPILLRWLTINCYPVKFGQCWVFGGVMCSVMRFFGI
PCRVITNYQSAHDNDRNLLIDVYHPDYGVRDMPSKDSVWNYHVWVEGWMKRPDLRPGYDG
WQVLDPTPQERSEGVFWCGPAPVKAVLNGDTDLKYNVPFVFAEVNADCVDWLVKRDGSKV
KIFSDSKRVGQNISTKSVGSDKRWNITSNYKHAEGSEEERAVFTYALTRDYSKVDKEEED
EEEESQEPTPDRQTTTVNGGGLNGPLVNGTGHGSSSSIVENGRDNITVCPPPLPPRPQIT
MKFQEVCKPLNGEDVKVNLVLHSDGLVPRILAVNVSVIAMSYNGSPLSTIQSELRKETLP
PGEDLIIPAVVSFSEYWQPMLNSDVMKISAVVSDTNAPDQVFLAETDLVLIDPPLEIKLL
NEPRVFREVVLQVSFVNPVGETLKDCSLTLSGSGLWREEQHVSLPEISPKSKVIVNVCFY
PYQSGVKTLVADFDCSMFRDIKSTLGIPVKDSIFFRF
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgactacacaatctccaaacactaacatcctgggggtggacttcaagccggcgcagaac
aacccgctgcaccacacgggggcgctgtccaaacacctgctcatcgtgaggagaggacag
agcttcagcatgcacatccagttcaaccacccgttcatcagcggcctacacaagctcatc
ttcactgccaccacggggctgtatccaggagaggacataggaaccaagtgcgtgtttggg
ctcccagatttggtgaatcgctcggctaaagctaaagccatctggagcgtcgtcatggat
accagaatgtcctatctggaaatgggaaacctacatctaaccgtcactcccccggcgaac
gctccagtgggaaaatacctactgtttctggatgaggcaggagagcagaaggagctgggg
tctctggtggtgctcttcaacccctggtgcccaactgactgggtgtacatgccagaggag
gccgaccgtcaggagtacgtgatgaacacacacgggatcatttacaaagggaccgggaac
tacatcacctccatggcctgggacttcgcacagttcgaggagaagatggtgcagatctgc
ctgatgctcttggacctgagccacaaacacctcaaagacccggcggatgacgtctcggct
cgctgtaaccccatctacgtcagcaggatcatcagcgccatgataaacagtgaggatgac
cgcggcgtgctgatgggccgttggggtgacaactttaccggaggcacgcccccgtctcac
tggagcggctcctatcccatcctccttcgctggctcactatcaactgttaccctgtcaag
ttcggacagtgctgggtcttcggtggagtgatgtgctcagtgatgcgtttcttcgggatc
ccgtgtcgtgtgatcacaaactaccagtctgcccacgacaacgacagaaacctgctcata
gacgtgtaccaccccgactatggggtccgggacatgccctctaaggacagtgtgtggaac
taccatgtgtgggtggagggctggatgaagagacctgatcttcgtcctggatacgacggg
tggcaggtgctggacccgacccctcaggagagatctgaaggagtgttttggtgtggtccc
gccccagtcaaagccgttctaaatggagacacagatctgaaatacaacgtcccatttgtg
tttgcggaggtcaacgcagactgtgtcgactggctggtaaaaagggacgggtccaaggtg
aagattttctcagattcaaaacgagtgggtcagaacatctccaccaagtctgtgggctcc
gacaaacgctggaacatcaccagcaactacaagcacgcagaaggaagtgaagaggagcga
gctgtctttacatacgccttgaccagagattattccaaagttgacaaggaagaggaagac
gaggaagaagagtcccaagagcccactccagatcgccaaaccacaactgtgaacggaggg
ggtctgaacgggcccctggtgaacgggactgggcacgggtcctccagtagcatcgtcgag
aatggaagagacaacatcactgtctgtcctccacctctacctccacgtccacaaatcacc
atgaaattccaagaggtgtgtaaaccgctgaacggtgaggatgtgaaggtgaacctggtg
ctgcacagtgatggtctcgtgcccagaattctggccgtcaacgtgagcgtgatcgccatg
agctacaacggatctcctctgtccaccatccagtccgagctcaggaaggagactctgcca
cccggagaagacctgattatccctgcagtagtatctttctctgagtactggcagcccatg
ctgaacagcgacgtgatgaagatctccgctgtggtgtcagacaccaacgccccagatcag
gtgttcctggcagagaccgacctggtgctgatcgatccgcccctagagatcaagttgctg
aatgaacctcgagtgtttcgtgaggtcgtcctgcaggtttccttcgtgaaccctgtgggt
gagactctgaaggactgcagcctcactctgtccgggagcggtctgtggagagaggagcag
cacgtcagcctgcctgaaattagtccgaagagcaaagtgattgtgaacgtgtgtttttac
ccctatcagtccggagtgaagactttggtggcggactttgactgttctatgttcagggac
atcaagagcaccctcggcatcccggtgaaagacagcattttcttcagattctaa

DBGET integrated database retrieval system