KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110162706Help
Entry
110162706         CDS       T05002                                 

Gene name
sod2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
bpec04068  FoxO signaling pathway
bpec04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:bpec00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    110162706 (sod2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    110162706 (sod2)
Enzymes [BR:bpec01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     110162706 (sod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 110162706
NCBI-ProteinID: XP_020783266
LinkDB All DBs
Position
Unknown
AA seq 231 aa AA seqDB search
MNMLCRSSQIRRCAAVGLSHSLSLASASTPSRHKHTLPDLMYDYGALEPHISAEIMQLHH
SKHHATYVNNLNVTQEKYQEALAKGDVTTQVALQPALRFNGGGHINHTIFWTNLSPNGGG
EPQGELMEAIKRDFGSFQNMKDKMSAATVAVQGSGWGWLGFDKESGRLRIAACANQDPLQ
GTTGLIPLLGIDVWEHAYYLQYKNVRPDYVKAIWNVISWENVSDRLKDAKK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgctttgcagatcatctcaaatccgcagatgtgcggcggtcgggttgagtcac
tcgctgagcctggcgagcgcgtccactccgtccagacacaagcacactctgcccgacctc
atgtacgactacggagctctggagccccacatcagcgccgagatcatgcagctccaccac
agcaagcaccacgccacctacgtcaacaacctcaacgtcacccaggagaagtaccaggag
gctctagcgaagggagatgttacaacacaggtggccctgcagcctgcgctcaggtttaac
ggaggcggccacattaaccacacgattttctggactaacctctcgcctaatggaggcgga
gagcctcaaggtgagctgatggaggccattaagcgcgacttcggctccttccagaacatg
aaggacaagatgtctgctgccacagtggccgtgcagggctccgggtggggctggctcggc
ttcgataaagagagcggaagactgcgcatcgccgcctgtgccaaccaggacccactgcag
ggcaccaccggtctgatccctctcctgggcatcgacgtctgggagcacgcctattacctc
cagtacaagaacgtgcgcccggactacgtgaaggccatctggaacgtcatcagctgggag
aacgtcagcgacaggctcaaggacgccaaaaagtag

DBGET integrated database retrieval system