KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110164382Help
Entry
110164382         CDS       T05002                                 

Definition
(RefSeq) prostaglandin G/H synthase 1-like
  KO
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpec00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    110164382
Enzymes [BR:bpec01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     110164382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 598 aa AA seqDB search
MGATRVVSYLSLMAFLGCLLENSSVAAADSNTVNPCCYYPCQNSGVCVRFGTDQYQCDCT
RTGFYGDNCTVPEFGSWIRLMLKPSPFVTHYILTHFQWFWNLLNNTFLRDMVMRLVLTIR
SNLIPSPPTFNTKYGYISWESYYNISYYTRLLPPVPEDCPLPMGTKGKPTLPDPKVLAER
FFKRKKFRPDPQGTNLMFAFMAQHFTHQFFKTNHEVKGGFTKALGHGVDASNIYGDTLER
QHQLRLHKDGKLKYQLVGSEVFPPTVSEAPVYMRYSQGLPSEQQFALGHELYGILPGLTL
YATLWLREHNRVCDILRAEHPSWDDEQLFQTTRLIIIGEIIKIIIEEYVQHLSGYFLKLK
FDPVLLFNERFQYSNRIALEFCQLYHWHPLMPDSFIIDDEEVSYSQFMYNTSLLTHYGVE
KLVDSFSRQVAGQIGGGHNSHETVLRVAELTIKESREARIQPFNEYRKKFNLKPYTSFYE
FTDDPEMAKGLEDLYGEIDALEFYTGVMLEKARPDAIFGESMVEMGAPFSLKGLLGNPLC
SPEYWKPSTFGGETGFRIVKSATLQKLVCHNSKWCPYVHFQVPGKEEEANSRKPSTEL
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgggagccactagagtggtgtcctacctgtccctgatggcgtttctgggctgtttgctt
gagaattcaagcgttgctgctgctgactcaaatactgtgaacccttgttgttactaccca
tgtcaaaactcaggagtgtgcgttagatttggcactgaccaatatcagtgcgactgcacc
cgaaccggtttttatggagacaactgtacagttccggagttcgggtcttggattcgtctc
atgttaaaacccagtccctttgtcactcattacatcctcactcacttccagtggttctgg
aacctgttaaataacacttttcttagagacatggtcatgagattagtactcactatcaga
agcaatcttatccccagtcctccaacgttcaacactaaatatggatacataagctgggag
tcctattataacatctcatactacactcgacttctacctcctgtgcctgaagactgtcct
ctgccaatgggaaccaagggcaaaccaactcttcctgatcctaaagtgctagcagaacga
ttctttaagagaaagaaatttaggccagatcctcagggaaccaatttgatgtttgccttc
atggctcagcactttacccatcagttctttaaaactaatcatgaagtcaaaggaggtttc
acaaaggctttgggtcatggtgtggatgcaagtaatatctatggagatactctggaacgt
caacatcaactcagacttcacaaagatggaaaactcaaataccagttagtcggcagtgag
gtcttccctcccacagtgtctgaagcccccgtgtacatgaggtattcacaaggccttccc
tctgaacagcagtttgcgcttggtcatgagctctacggcattttgccaggcctcaccttg
tatgccaccttgtggctgagagagcacaaccgcgtatgtgacatcctgagagcagagcat
ccctcctgggacgacgagcagctctttcagaccaccaggctcatcatcatcggtgagatt
atcaagatcataatagaagagtatgtgcagcacctgagcggctacttcctgaaactcaag
tttgacccagtgcttctgttcaatgagcgttttcagtacagtaaccgcatagcactagag
ttctgccagctgtaccactggcaccccctgatgccagacagcttcatcatcgacgatgaa
gaagtctcgtattcacagtttatgtacaacacttccctcctcacacactatggggtggaa
aaactggttgactctttctctcgacaagtggctggacagattggtggaggccacaactct
catgagactgtgctcagagtagcagaactgaccatcaaggagtcaagagaagcacgcatt
caacctttcaacgaatacaggaagaagtttaacttaaaaccatatacatccttctatgaa
tttactgatgacccggagatggccaaaggtttagaggacctttatggagaaatagatgct
ctggagttttatacaggtgtgatgttagagaaagcacggcctgatgccatctttggggag
agcatggtggaaatgggcgctcctttctccctgaaaggtttacttggaaatcctctctgc
tcaccggaatactggaagccgagcacatttggaggagagactggttttcgcatagtcaaa
agtgcaactctgcaaaaactcgtgtgtcacaattcaaaatggtgtccatatgtacatttt
caggttccagggaaggaagaggaggcaaactccagaaaaccgtctactgaactttga

DBGET integrated database retrieval system