KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110170777Help
Entry
110170777         CDS       T05002                                 

Definition
(RefSeq) coagulation factor XIII A chain-like
  KO
K03917  
coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Brite
Enzymes [BR:bpec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     110170777
Cell adhesion molecules and their ligands [BR:bpec04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     110170777
   VLA-9
     110170777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 742 aa AA seqDB search
MSDQSASTISSAPPPPPSGPRPKINSRGRAAGPAANSNADISDIPELEYFGAPGPRGYPP
LTEFLDIQNVDMKHRPQDKNRRSHKTHLFNLDALVVRRGQEFEVEITFNRPYKPSEDKFA
VEFVIGSSPQYSKGTYMPVFTTKDRQTSWKGRIINMIENTVIMGITPDPTCIVGKYHMYV
AVVTPYGIRRTKREPIRDLYILFNPWAADDEVFLNDETERQECVMNEMGIIYHGSYDDIA
ERTWNFGQFNYGILDACLYILDRSQMPITNRGDAVKVVRQASAMLNSRDDDGVLVGNWSG
DYTYGVAPTSWTGSTDILLTYANSQSSVCYAQCWVYAAVFNTFLRCLGIPARVVTNFFSA
HDNNGNLKTDIILDENGRIDRKQTRDSIWNYHCWNECYMARKDLPAGFGGWQVVDATPQE
NSDGMYRCGPASVYAIKHGQMCYPYDAPFVFAEVNSDVVFYQRGKDGTLEPVKVNHTHVG
RGIFTKTPGELTRKEITDQYKFEEGSTEERTVLEKAEVYGCKRELLDPPPADVDLVLPSV
ELAVGQDLELSVEFVNHSQQRRTVDAYVSGSVVYYTGVTSSEFLFRTPTVTIGPNKSVKE
LVDIEARSYMKHLVEQANLNFIVTGKVKETGQIVTAMKVVTLHNPKVSIQVSGVARVNEE
MLATLQFTNPFNFNLEGVYVRMEGPGVMLPHYRYYNIVTPNSSVVWSEKFSPQRPGTTRI
IASLDCPALRHVYGEESFTVEP
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaccaatccgcttccaccatctcctctgcccctccccctcctccctccgggccg
cgccctaaaatcaacagcagagggcgcgctgctggcccggccgccaactcaaacgctgac
atttcagacatcccggagctcgaatactttggggcacctgggcccagagggtacccaccc
ttgaccgagtttttggacatccaaaatgtggacatgaaacatcgtcctcaagacaaaaac
aggaggagtcacaaaactcacctgtttaacctggatgccctggtcgtgaggcgcggacaa
gagtttgaagttgagatcacctttaaccgcccatacaagccctcagaggacaagtttgct
gtggagtttgtcattggctccagtcctcagtacagtaaaggcacctacatgcccgtcttc
acgaccaaagaccggcagacatcttggaaaggtcgtatcattaatatgattgaaaatacc
gtgatcatgggcatcaccccggaccccacctgcattgtgggtaaataccacatgtatgtt
gccgtggtaacgccctatggcatccgcagaaccaaaagagagccgatccgcgacctctac
atcctgttcaacccatgggcagcagatgacgaggtgtttctgaatgatgagacagagagg
caggagtgtgtgatgaacgagatgggaatcatttaccacggatcctatgacgacatcgca
gagaggacctggaactttggacaatttaactatgggattctggacgcttgtctgtacatt
ctggatcgttctcagatgcccatcaccaacagaggagacgccgtcaaagtggtgcgccag
gcctcagctatgctgaactcccgtgatgatgatggagtgctggtggggaactggagtggg
gactatacctacggagtggcccccacctcctggaccgggagcacagacatcctgctgacc
tacgccaacagccagagttcagtctgctacgcccagtgctgggtctatgctgctgtcttc
aacacctttctgcgttgtcttgggatccctgctcgagtggtcaccaacttcttctccgct
cacgacaacaatggaaacctgaaaacagacatcattctggacgaaaatggcagaatcgac
cgcaaacaaacaagggactcaatttggaactaccattgctggaacgagtgctacatggcc
agaaaggacctccctgcaggtttcggaggctggcaggtcgtggatgctacaccacaggag
aacagtgatggcatgtacagatgtggacctgcctctgtctacgccatcaaacacgggcag
atgtgttacccctatgacgccccctttgtctttgctgaggtgaacagcgatgtggttttc
tatcagcgtggtaaagatgggaccctggagccggttaaagtgaaccacactcatgttgga
cgaggcattttcaccaaaacacctggagaactaacccgcaaagaaatcactgaccaatac
aagtttgaagaaggcagcacagaggagcgtacagtgctggagaaggccgaggtgtacggg
tgtaagcgcgagctgttggacccccctcccgcggatgtggatctggtgctgccctctgtg
gagctcgctgtggggcaagacctggagctcagcgtggagtttgtgaaccacagccaacag
cgccgcacggtggacgcttatgtgagcggcagcgtggtctactacaccggagtcaccagc
tctgagttcctcttcaggacccccactgtcaccattgggcccaacaagagtgtgaaggag
ctcgtggacattgaggctcggagctacatgaagcacctggtggaacaggccaacctcaac
ttcatcgtgaccggaaaagtgaaggagaccgggcagatcgtcaccgccatgaaagtggtg
actctgcacaaccccaaagtcagcatccaggtgtctggagtggccagagtgaacgaggag
atgttggccaccctgcagttcacaaacccattcaactttaacctggaaggagtctacgtg
aggatggaggggcctggagtcatgctgccacactacagatactacaatattgtgacccca
aactcgtctgtggtttggtctgagaaattcagtccacagagacccgggaccaccaggatc
attgcgagtctggactgtcccgcgctcagacatgtctacggagaggagtccttcactgtg
gagccgtag

DBGET integrated database retrieval system