KEGG   Boleophthalmus pectinirostris (great blue-spotted mudskipper): 110175417Help
Entry
110175417         CDS       T05002                                 

Definition
(RefSeq) hexokinase-1-like isoform X1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
bpec  Boleophthalmus pectinirostris (great blue-spotted mudskipper)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bpec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110175417
   00051 Fructose and mannose metabolism
    110175417
   00052 Galactose metabolism
    110175417
   00500 Starch and sucrose metabolism
    110175417
   00520 Amino sugar and nucleotide sugar metabolism
    110175417
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110175417
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    110175417
Enzymes [BR:bpec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     110175417
Membrane trafficking [BR:bpec04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110175417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 918 aa AA seqDB search
MIAAQLLAYYFSELKDDQVKRIDKYLYSMRFSDETLLDITQRFRRELVKGLGRDTNPTAA
LKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVSHQKKQTVQMESEIYDTPEDIIH
GTGQRLFDHVAECLGDFMEKHHIKDKKLPVGFTFSFPCQQTKLDEGYLITWTKRFKASGV
EGMDVVQLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDLMEGDEGRMCVNTEWGAFGDDGGLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAREGLLFEGRITPELLTKGTIETKHISAMEKNKEGLSRTKEILTKLG
VEPSSDDCIAVQHVCAIVSFRSASLIAATLAGILLRLKENKHVTRLRTTVGIDGSLYKMH
PQYSRRLHKTVRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQSRQIAQTLAEFRLT
TEQLLEVKKRMRTEIENGLSKSTQDIATVKMLPTYVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRSVEMHNKIYAIPLEVMQGTGEELFDHIVHCISDFLDYMGMKSARLPLGF
TFSFPCKQNSLDAGILVTWTKGFKATDCEGEDVVGLLREAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEIGLIAGTGSNACYMEEMRNIEMVEGDEGQMCVNMEWGAFGDNGCLDD
FRTEYDRSVDDLSLNPGHQRYEKMCSGMYLGEIVRNILIDLTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRSILQHLGLDSTCDDSIIVKEVCGAVSYRAAQLCGAGMAA
VVDKIRENRGLDFLNITVGVDGTLYKLHPHFSQIMHQTVKELAPQCDVNFLLSEDGSGKG
AALITAVGCRMRNEMNGK
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcagcccagctactagcttattacttctctgaactcaaggatgaccaggttaag
aggattgacaagtacctgtactccatgcgcttctctgatgagacactgttggacatcaca
cagaggtttcgcagggagctggtcaaaggactaggacgggatacgaaccccacggctgcc
ctaaaaatgctgccgacatttgtgcgctcaattccagatggatcagaaaagggagatttc
attgccttagatttgggtggcagtaactttaggatcctccgtgtgaaagtgagccaccag
aagaaacagactgttcaaatggagagtgaaatctatgacacacctgaagacattattcac
gggacaggacaaaggctgtttgaccatgtggcggagtgtctgggtgactttatggaaaaa
caccacatcaaagacaagaagctacctgttggatttactttctcctttccctgccaacaa
actaaactagatgagggatatcttataacttggacaaaacgcttcaaagctagtggtgta
gagggaatggatgttgtgcagttgttaaataaagctattaaaaaacgtggggactatgaa
gcagacattatggcagtggtgaatgacacagtgggaacaatgatgacgtgtggatttgat
gaccagcgctgcgaagttggaattattattggtactggcactaatgcgtgttacatggag
gagctgcgtcacattgacttgatggagggggacgagggccggatgtgtgtgaacactgag
tggggggcttttggagacgacggcggactggaggacatcagaaccgagtttgacagagag
atagacagaggctcactgaaccctggaaaacagctatttgaaaagatggttagtggcatg
tacatgggggagttggttcgtctcattctggtgaagatggctcgagaaggtttgttgttt
gaaggcaggatcacaccagagctcctcaccaaaggcaccatagaaaccaagcacatctca
gcgatggaaaagaacaaggagggactgtcccggaccaaagaaattttaaccaaacttggt
gttgagccttcatcagatgactgtatagctgtacaacatgtttgtgccattgtgtctttc
cgctcggccagtttgattgctgctactttggctgggatcttattgaggctaaaggaaaac
aaacatgtgactcgtctgcggaccacagtcgggattgatgggtccctgtacaaaatgcac
ccacagtactctcgccgtcttcacaaaactgtacgccgtctggtcccagattctgatgtt
cggtttcttctgtctgagagtggcagtggaaagggcgctgccatggtgactgctgtggcc
tatcgactggcagaacaatcacgacaaattgctcaaacgttagcagagtttcgactgacc
actgaacagttactagaggtgaagaagcgtatgagaacagagattgaaaatggtttatca
aaaagcactcaagacattgccacagtcaaaatgttgcctacatatgttcgaagcactcct
gatggcacagagaatggagatttcctagctttagatttaggaggaacaaatttcagagtt
ttgctggtcaagatccgctctgggaaaaggcgttcagtagaaatgcacaacaagatttac
gcaattcctctcgaagttatgcagggaacaggagaagaattgtttgatcacatcgtgcat
tgtatcagtgacttcctggactacatgggcatgaaaagtgctcgtcttcctctcggtttc
acattttctttcccatgcaaacagaacagcctggatgctggaatactggtaacatggacc
aagggattcaaagcaacagactgtgaaggagaagatgttgtgggactgttgagggaagca
attaagaggagagaggagtttgaccttgatgttgtggctgtagtcaacgatacagtggga
acaatgatgacctgtgcctatgaagagccaacctgtgagataggcctcattgctggtacg
ggtagtaatgcgtgctacatggaggagatgagaaacattgagatggtcgagggagatgag
ggtcagatgtgtgtcaacatggagtggggagcctttggtgacaatggttgtctcgatgac
ttcaggaccgaatatgaccgctctgtagatgacttgtctctcaatccgggccatcaaaga
tatgaaaagatgtgcagtgggatgtatcttggtgaaattgtgaggaacatcctaattgac
ctaaccaaaaggggattcctgttccgaggtcaaatctcagagacactaaaaaccagaggc
atttttgagacaaagttcctttcgcaaatagaaagtgaccgtctggcattactgcaagtg
agatctattctccaacatttaggtctggacagcacgtgtgatgacagtatcatagttaaa
gaggtatgtggagccgtgtcataccgtgcagctcagctgtgtggggcaggaatggcagct
gtggtcgataaaatcagagaaaaccgaggactagactttctcaacatcactgtaggagtg
gatgggactctttacaaactgcacccacatttctcccaaatcatgcaccaaacagtgaag
gagctggcgcctcagtgtgacgtcaacttcctgctctcagaggatggcagcggcaaaggc
gctgccctcatcactgctgtgggctgcaggatgaggaatgaaatgaacggcaaataa

DBGET integrated database retrieval system