KEGG   Bacillus pseudofirmus: BpOF4_03385Help
Entry
BpOF4_03385       CDS       T01165                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bpf  Bacillus pseudofirmus
Pathway
bpf00010  Glycolysis / Gluconeogenesis
bpf00030  Pentose phosphate pathway
bpf00051  Fructose and mannose metabolism
bpf00052  Galactose metabolism
bpf00680  Methane metabolism
bpf01100  Metabolic pathways
bpf01110  Biosynthesis of secondary metabolites
bpf01120  Microbial metabolism in diverse environments
bpf01130  Biosynthesis of antibiotics
bpf01200  Carbon metabolism
bpf01230  Biosynthesis of amino acids
bpf03018  RNA degradation
Module
bpf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BpOF4_03385 (pfkA)
   00030 Pentose phosphate pathway
    BpOF4_03385 (pfkA)
   00051 Fructose and mannose metabolism
    BpOF4_03385 (pfkA)
   00052 Galactose metabolism
    BpOF4_03385 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BpOF4_03385 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BpOF4_03385 (pfkA)
Enzymes [BR:bpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BpOF4_03385 (pfkA)
Protein phosphatases and associated proteins [BR:bpf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BpOF4_03385 (pfkA)
Messenger RNA biogenesis [BR:bpf03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BpOF4_03385 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK PGP_phosphatase NAD_kinase DUF4347
Motif
Other DBs
NCBI-ProteinID: ADC48743
UniProt: D3FWY8
LinkDB All DBs
Position
complement(2950473..2951432)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHDLEVYGISYGYAGLIAGDIRKMELGSVGDI
IHRGGTMLYTARCEEFKTLEGQKKGIEQLKKFGIEGLVVIGGDGSYRGAQKLTEHGFPTI
GVPGTIDNDIPGTDYTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDLALWS
GLADGAETIVIPEADYEMNQIISRLERGQERGKKHSIIIVAEGAGSGMDFGKRISDATQM
ETRVTVLGHIQRGGSPTGADRVLASRLGAKAVDLLLEGEAGRTVGIQNNKLVHHDINEVL
AQPHSVDLDMYKLSQELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattggagtattaacaagtggtggagattcaccgggaatgaatgccgcgatc
cgtgcggttgtccgtaaagcaatctatcatgatttagaagtgtatggaatctcttacgga
tatgcaggtctaattgctggtgatattcgtaaaatggaacttggttcagtaggtgatatt
attcatcgcggcggaactatgctctacactgcacgctgtgaagagtttaaaactcttgaa
ggacagaaaaaaggaattgaacaacttaagaaatttgggattgaagggcttgtagtaatc
ggcggcgacggttcttaccgtggtgctcaaaaactgacagaacatggcttcccaacgatt
ggtgttcctggtacgattgataatgatattcctggtacggactatacgatcggatttgat
actgcgctgaatacagttattgatgccatcgataaaattcgtgatacggcgacttcgcat
gagcgtacctatgttattgaagtaatgggtcgtcatgctggagaccttgctttatggtca
gggcttgctgatggggcagaaacgattgttattccagaagcagattacgaaatgaatcaa
atcatcagtcgtctagaacgtggacaagagcgcggcaagaagcacagtatcattatcgtt
gcagagggtgcaggcagcggtatggactttggtaaacgtattagtgatgctacacagatg
gaaacacgtgtaaccgtgcttggtcatattcagcgaggcggatctccaacaggggcagat
cgtgtgcttgctagccgtttaggagcgaaagctgtcgatcttctacttgaaggagaagct
ggtcgtacggtaggaattcaaaataataagttagtccatcatgacatcaatgaagtacta
gctcagccacactccgtcgatcttgacatgtacaagctttcacaagaactttccatttaa

DBGET integrated database retrieval system