KEGG   Paraburkholderia phymatum: Bphy_7006Help
Entry
Bphy_7006         CDS       T00704                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
bph  Paraburkholderia phymatum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
pBPHY01:1662615..1665503
Genome map
AA seq 962 aa AA seqDB search
MARTLDLRLSKRSRDMNDDAVGRSSANARRLLEIVDAFAAEMSPGRHKPPPAGLGSHFER
DLGLDSLARTELLNRIEKTLGVRFPLELFGQAITPGDLLRALDGRTTGRPNAPTGAIALD
APGGALDPAADAGTLVEALQWHASRRPERTHIVLLDEDAAPHAMTYAALHEAALRVSRGL
RQIGVNPGDTVALMLPTGSDYFACFAGILLLGAIVVPVYPPAQSARIDDHLARHAAILSD
ARARVMIVPSHAFVAGVMAKARIPTLHEIVAVPQLMGEMDAEQYVPRAEDVALLQYTSGS
TGTPKGVVLTHANLLANIRAMGHTALIEEHDVFVSWLPLYHDMGLIGAWFGPLYFGIPLV
LMSPLTFLARPARWLHAISDYHATITAAPNFAYERCARRVDDTDLEDVDLSSLRLAFCGA
EPVSAATMRAFASRFARNGFRHTALTPVYGLAENTLGLAFSEPGRGVRTDCISRVRLADS
QRAAPAESPDEVLELVSCGRALPRNQIRIMDADGNEVSERAVGRIEFRSPSATRGYFQNP
NLTARLIHDGWLDTGDLGYMADEELFITGRVKDLVIRAGRHFYPYELEAAVGRLPGVRTG
CVAVCGTPDVETGTDRLLVIAETRATAPATLAAIRSGINEASVALLGAPPEEVALVPPHS
ILKTSSGKIRHAATLDLYMRSRGNLLPRPAWRQWLDIGANTLLPLGRRLRIAAGRFAYGA
WCWISTMLIAIPTALIIVWHPDANRNWKIASRAARLTLRLAGISLTVRGGALFDTAQPAI
YVANHASYLDGLVLLAAFPVPLGVVAKRELARAPLLGCFLRAIGVRFVERVDYRRMADDE
RELAKQAMSGTSLLFFPEATFVRSAGLRQFRLGAFVTACASHRPIIPVAIAGTRAVLPDG
QWLPIRAAVTVTVLPAQVPSGEDMKAAARSRDAAREAIAAYCGERVLSEISPLEIPTRHD
AT
NT seq 2889 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtacgctggatctccgcctctcaaagcggtcacgtgatatgaacgacgacgct
gtcggccgctcgtcggccaatgcccgcaggttgctcgagatagtcgacgcgttcgcggca
gagatgagtcccgggaggcataagccaccacccgcgggactgggcagccacttcgaacgt
gacctcggcctggacagtcttgcccgcacagaactgctgaaccgcatcgagaaaacgctc
ggcgtacgctttccgcttgaactgttcgggcaagcgataacgccaggtgatttactgcgc
gccctcgatgggcgaacgaccgggcggcccaacgcccccaccggcgccatcgcgctcgac
gcgccaggcggtgcactagacccggcagccgatgcaggaacgttagttgaagcactgcag
tggcatgcatcccggcgaccggaacgcactcacatcgtattgctcgacgaggacgcggca
ccacatgcgatgacctatgcagcactgcacgaggcagcgctacgggtatcgcgcgggttg
cgccagatcggcgtcaatccgggagataccgtcgccttgatgctgccaacaggcagcgac
tatttcgcatgctttgccggcatactgctgctgggcgccatcgtcgtgcccgtctatccg
ccagcccaatccgctcggatcgacgatcatcttgcgcggcacgcggcgattctgtccgat
gcgcgcgcacgcgtcatgatcgtgccctcacacgcgtttgtagcgggcgttatggccaag
gcgcggataccgacattgcatgagatcgttgcagtgcctcaactcatgggcgagatggat
gccgagcagtatgtgccgcgcgcagaagacgtcgcgctgctgcagtacacctcgggcagc
acgggtacgccaaaaggcgtggtgctcacccatgccaatctgctcgccaacatccgggcg
atgggtcacacggccctgatcgaggaacacgacgtctttgtaagctggctcccgctgtat
cacgatatgggcctgatcggcgcatggttcggcccgctctacttcggtattcctctggtt
ctgatgtccccgctgacattcctcgcacgtccggcgcgctggcttcacgcgatcagtgac
taccacgccaccattacggcggcgcccaacttcgcctatgagcgttgcgcacgcagggtc
gacgataccgatctcgaagacgtggatctatcctcattgcgccttgcattctgtggcgcg
gagcccgtcagtgcggccaccatgcgggcattcgcctcacggtttgctcgcaatggcttc
cggcacactgccctgactcctgtctacggccttgcagaaaatacgcttggactggcgttt
tcggagccgggacgaggcgtgcggacagattgcatcagccgcgtccgactggctgactcc
cagcgtgctgcaccggcagaatctcccgatgaagtgcttgaactggtgtcgtgtggacgg
gcattaccccgcaaccagatccgtattatggatgccgacggtaacgaggtgtctgaaagg
gcggtcggccggatcgaattccgcagtccgtccgcgacgcgtgggtattttcagaacccc
aatctgaccgcgcggctgattcacgatggttggctcgatactggcgatctgggatacatg
gccgacgaagaactgtttatcacgggccgcgtgaaggatctggtgattcgggctgggcgg
catttctacccgtatgaactggaagcggccgtcgggcgtctacctggcgtacgaaccggt
tgcgtcgcggtgtgcgggacgcctgacgtcgagacaggcaccgatcgactgctcgtcatc
gcggaaactcgcgcaaccgcgccggccacgctcgcggcgatacgcagcggcattaacgaa
gcctctgtggccctgctgggcgctccgccagaagaagtcgccctcgtaccgccacacagc
atcctgaagacatccagcggcaagatccgccacgcagccaccctggatctgtacatgcgc
agtcgcgggaatctgctgccgcgccccgcgtggcgccagtggctcgacatcggcgcgaac
actctgctgccgctcggccgacggcttcgaattgccgccgggcgcttcgcttacggtgca
tggtgttggatcagcacgatgcttatagcgatacccacagcgctcatcatcgtgtggcat
ccggacgctaatcggaactggaaaatagcatcgcgcgccgcgcggctgaccttgcggctt
gcaggaatttccttgaccgtacgcggcggggctctctttgacaccgcgcagccggccatc
tacgtcgccaatcacgcgagttatctggacgggctcgtgctgctggccgcgtttcccgtc
ccgctcggcgtcgttgcaaagcgtgagctggcccgcgcacccctgctcggctgcttcctt
cgcgcgataggcgtacgcttcgtcgaacgcgtggactatcggcgcatggctgacgatgag
cgcgaactggcaaagcaggcgatgtccggaacctcgctgctcttctttcccgaagctacg
ttcgtcaggtccgcgggtctgaggcaattccggctcggcgctttcgttaccgcgtgcgct
tcgcaccggcccatcattcctgtggcaatcgcggggacgcgcgctgtgctgccggatggg
cagtggttgcccatccgagccgccgtaacagttaccgtgcttcccgcccaggtaccatcg
ggagaagacatgaaggcagcggcacgctcgcgcgacgccgcgcgcgaggcgatcgccgct
tattgcggagaaagagttctgagcgaaatttccccactggagatccccactcgccacgac
gctacgtga

DBGET integrated database retrieval system