KEGG   Blattabacterium BPLAN (Periplaneta americana): BPLAN_044Help
Entry
BPLAN_044         CDS       T00996                                 

Gene name
kgd
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bpi  Blattabacterium BPLAN (Periplaneta americana)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BPLAN_044 (kgd)
  Amino acid metabolism
   00310 Lysine degradation
    BPLAN_044 (kgd)
   00380 Tryptophan metabolism
    BPLAN_044 (kgd)
Enzymes [BR:bpi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BPLAN_044 (kgd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
54353..57130
Genome map
AA seq 925 aa AA seqDB search
MSDRYSFLNAIHFKEIESLYKKYKENPNSIEPSWCAFFYGFDFNEENYQYLQEKKNTSTA
IQIEKNKKNFLPQPSVHTEFLVYNLIQNYRKRGHFFTKTNPIRERRKRYPSLDLKNFGLS
EKELDLHFEVGKIIGIGKNSLRNIINHLKNIYCNSIGIEYMYISDPKKIEWIEKWFQKEK
FEFPAEKKKFFLKKLNEAVAFENFVHTKFVGQKRFSIEGNESILPALEEMMEYTSKRYFT
EDFVIGMPHRGRLNLLSNFFQKNYSHIFSEFQGKEYKEKSFSGDVKYHLGFTKIRKNRQG
RYIKMSLVPNPSHLESVDAIVEGITRSKIDINYNQNSNSEKIIPILIHGDAALSGQGIVY
EVIQLSRLKGYKTGGTIHIVINNQIGFTTDYTEGRSSIYCTDIAKIVLSPVLHVNADDIE
SVIHAVHFAVDFRMHYHEDVFIDLLGYRKYGHNEGDEPRFTQPTLYKAISKHPNSYNLYK
EKLEKEGLISTGEIQKMEKEYEEILNEGYNEAKNIKWNVLNSFLEEEWKNFPIVSNTDEI
FKKVNTQFPIEKLIKISEKIFTLPKNKKFFRKTEHLFKQRLEMVKKNLVDWSISELIAYG
TILYEGFHIRLSGEDVGRGTFSQRHAIIKTEEEEEIILLNRIRMGQGKMQVYNSPLSEYG
VLGFDYGYAMYSPYTLTLWEAQFGDFGNGGQIIIDQYISSGENKWKIRNGIVMLLPHGYE
GQGPEHSSARVERYLQLCANNNLFVVNCTTPANFYHLLRRQMKLNFRKPLIVFTPKSLLR
HPKCLSKMEELSEGEFQEILDDPSDMGDIEKITKLILCSGKIYYDLLKKKEFLRDEKTAI
IRIEQIYPLKKDKIQELFNKYKNKKSIFWVQEEPENMGFWSFIFRKIGKDFPFKLIAPSE
SSSPSTGSYPDFLKIQNNLLEKAFL
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatagatattcatttttaaatgccatccattttaaagagatagaatctctctat
aaaaaatataaagaaaatcctaattcaatagaacccagctggtgtgcttttttttatgga
tttgattttaacgaagaaaattatcagtatcttcaagaaaaaaaaaacacttccactgct
attcagatagaaaaaaacaaaaagaatttcctcccacagccatccgtacatacagaattt
ttagtttataatttgattcaaaattataggaaaagaggtcatttctttaccaaaacaaat
ccaatacgagaaagaagaaaacgttatccttctttagatttaaaaaattttggattatct
gaaaaagagcttgatcttcatttcgaagttggaaaaataattggaataggaaaaaattcc
ttaaggaatatcattaatcatctcaaaaatatttattgcaattcaatagggatagaatac
atgtacatttcggatccgaaaaaaattgaatggattgaaaaatggtttcaaaaagaaaaa
tttgaatttcctgcagaaaagaaaaaattttttctgaaaaaattaaatgaagcagttgca
tttgaaaattttgttcatactaaatttgtgggtcaaaaaagattttctattgaaggaaat
gaatctatattacccgcattggaagaaatgatggaatatacttccaaaagatatttcacc
gaagattttgtgataggaatgccccacagaggacgtttaaaccttctttctaactttttt
caaaaaaactattctcacatattcagcgaatttcagggaaaagaatataaagaaaaaagc
ttttctggtgatgttaagtatcatttaggttttacaaaaattagaaaaaatcgtcaagga
cgatatataaaaatgagtctagtcccaaatccatctcatttagaatctgtagatgctatt
gtagaaggaattactcgttcaaaaatagacattaactataatcagaatagtaattcagaa
aaaataatccccattcttattcatggagatgccgctttatcaggtcaaggaattgtttat
gaagtcatccaattatctagattaaaaggttataaaactggaggaactattcatattgta
attaacaatcaaattgggttcactactgattatacagaaggtcgttctagcatttattgt
acagatatagccaaaatagtactatctcccgttttacatgtaaatgcggatgatatagaa
tctgttattcatgccgttcattttgcagtagatttcaggatgcattatcacgaagatgtt
tttatagatttattaggatatagaaaatatggacataacgaaggggatgaacctcgtttt
actcaaccaactttatataaagctatttccaaacatcctaattcatataatttgtataaa
gaaaaattagaaaaagaaggattgattagtacgggagaaatacaaaagatggaaaaagaa
tatgaagaaattcttaatgaaggatataatgaagcaaaaaatattaaatggaatgtttta
aactcttttttagaagaagaatggaaaaattttcctattgtatctaatacagatgaaata
tttaaaaaagtaaatactcaatttccaattgaaaaacttataaaaatttctgagaagatt
tttactcttcctaagaataaaaaattttttagaaaaacggaacatcttttcaaacaaaga
ttagaaatggtaaaaaaaaatttggtagattggagtatttctgagttaatagcctatgga
acaattttatatgaaggatttcatattcgtttatcaggagaagatgtaggaagaggaact
ttttctcaacgtcatgctattataaaaacagaagaagaagaagaaattattctgttgaat
cgtattcgtatggggcaaggaaaaatgcaagtgtataattctccgctttctgaatatgga
gttttaggatttgattatggatacgctatgtattctccctatactttaactttatgggaa
gctcaatttggtgattttggaaatggaggacaaatcattatagatcagtatatttcctct
ggagaaaataagtggaaaattagaaatggaatagtgatgttacttcctcatggatatgaa
ggacaaggtccagaacattcctctgcacgtgtagaacgttatctacaactttgtgctaat
aataatttatttgttgttaattgtaccactcctgctaatttttatcatcttttgagacga
caaatgaagttaaattttagaaaaccacttatagtttttacacctaaaagtttgcttcgt
catccgaaatgtctatcaaaaatggaagaactttctgaaggagaatttcaagaaattttg
gatgatccttcggatatgggagatattgaaaaaatcaccaaattgattttatgctctgga
aaaatatattatgatctcctaaagaaaaaagaattcctcagagatgaaaaaactgctata
attcgtatagaacaaatataccctttaaaaaaggataaaattcaagagttatttaataag
tataaaaacaaaaaaagcattttttgggttcaagaagaaccagaaaatatgggattctgg
agttttattttcagaaaaataggaaaagattttccttttaaattaattgctccatctgaa
agttctagtccatctacaggatcttatcccgattttttgaaaattcaaaataacctattg
gaaaaggcttttttataa

DBGET integrated database retrieval system