KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_2666Help
Entry
BURPS1106A_2666   CDS       T00480                                 

Gene name
pdhB
Definition
(GenBank) pyruvate dehydrogenase complex E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00010  Glycolysis / Gluconeogenesis
bpl00020  Citrate cycle (TCA cycle)
bpl00620  Pyruvate metabolism
bpl01100  Metabolic pathways
bpl01110  Biosynthesis of secondary metabolites
bpl01120  Microbial metabolism in diverse environments
bpl01130  Biosynthesis of antibiotics
bpl01200  Carbon metabolism
Module
bpl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS1106A_2666 (pdhB)
   00020 Citrate cycle (TCA cycle)
    BURPS1106A_2666 (pdhB)
   00620 Pyruvate metabolism
    BURPS1106A_2666 (pdhB)
Enzymes [BR:bpl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BURPS1106A_2666 (pdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_D23 NQRA DEC-1_N
Motif
Other DBs
NCBI-ProteinID: ABN89889
UniProt: A3NX48
LinkDB All DBs
Position
I:complement(2626342..2627988)
Genome map
AA seq 548 aa AA seqDB search
MSQAIEVKVPDIGDYKDVPVIEVLVKPGDAVEPEQSLVTLESDKATMDVPSPSAGTVKEV
KVKVGDAVSQGSLIVLLDGAQAAAQPAQANGAATSAAQPAAAPAAAPAPAAAAGGGTVDV
KVPDIGDYKDVPVIEIAVKIGDTVEKEQSLVTLESDKATMDVPSPAAGVVKDIKVKVGDA
VSEGSLIVVLEASGGAAASAPQAAAPAPAPAPAPAPAPAPQAAPAAAPAPAQAPAPAASG
EYRASHASPSVRKFARELGVDVSRVTGTGPKSRITKDDVTAFVKGVMTGQRAAPGAAAAP
AGGGELNLLPWPKVDFSKFGPFEAKPLSRIKKISGANLHRNWVMIPHVTNNDEADITELE
ALRVQLNKEHEKAGVKFTMLAFVIKAVVAALKKFPTFNASLDGDNLVFKQYYHIGFAADT
PNGLVVPVIRDADKKGLVDIAKEMAELSKAAREGKLKPDQMQGGCFSISSLGGIGGTHFT
PIINAPEVAILGLSRGQMKPVWDGKQFVPRLTLPLSLSYDHRVIDGAEAARFNAYLGALL
ADFRRIIL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtcaaggtgccggatatcggcgattacaaggacgtgcccgtc
atcgaagtgctcgtgaagccgggcgatgcggtcgagcccgagcagtcgctcgtcacgctc
gaatcggacaaggcgacgatggacgtgccgagcccgtcggcgggcacggtcaaggaagtg
aaggtgaaggtcggcgacgcggtgtcgcaaggctcgctgatcgtgctgctcgacggcgcg
caggcggcggcccagcccgcgcaggcgaacggcgccgcgacgagcgccgcgcagccggcg
gcggcgcccgctgccgcgcctgcgccggcggcggccgcgggcggcggcacggtcgacgtg
aaggtgccggacatcggcgactacaaggacgtgcccgtcatcgagatcgccgtgaagatc
ggcgacacggtcgagaaggagcagtcgctcgtcacgctcgaatcggacaaggcgacgatg
gacgtgccgagcccggccgcgggcgtcgtcaaggacatcaaggtgaaggtcggcgatgcg
gtgtcggaaggttcgctgatcgtcgtgctcgaagcatcgggcggcgccgccgcgagcgcg
ccgcaggcggccgcgcccgcccccgcgccggcgcccgcgcccgcgcccgcgcccgcgccg
caggccgcacccgcggctgcgccggcccccgcgcaggcaccggcacccgccgcgagcggc
gagtaccgcgcgagccacgcgtcgccgtcggtgcgcaagttcgcgcgcgagctcggcgtc
gacgtgtcgcgcgtcacgggcacggggccgaagagccgcatcacgaaggacgacgtcacc
gcgttcgtgaagggcgtgatgacgggacagcgcgcggcgcccggcgccgcggccgcgccc
gcgggcggcggcgagctgaacctgctgccgtggccgaaggtcgacttctcgaagttcggc
ccgttcgaggcgaagccgctgtcgcgcatcaagaagatctcgggcgcgaacctgcatcgc
aactgggtgatgatcccgcacgtcacgaacaacgacgaggcggacatcaccgagctcgaa
gcgctgcgcgtgcaactgaacaaggagcacgagaaggcgggcgtgaagttcacgatgctc
gcgttcgtgatcaaggcggtcgtcgccgcgctgaagaagttcccgaccttcaacgcgagc
ctcgatggcgacaacctcgtgttcaagcagtactaccacatcggtttcgccgccgacacg
ccgaacggcctcgtcgtgccggtgatccgcgacgcggacaagaaggggctcgtcgacatc
gcgaaggaaatggccgagctgtcgaaggccgcgcgcgaaggcaagctcaagccggaccag
atgcagggcggctgcttctcgatctcgtcgctcggcgggatcggcggcacgcacttcacg
ccgatcatcaatgcgccggaagtggcgatcctcgggctgtcgcgcggccagatgaagccg
gtgtgggacggcaagcagtttgtgccgcgcctcacgctgccgctgtcgctgtcgtatgac
catcgcgtgatcgatggcgcggaagccgcgcggttcaatgcgtatctcggcgcgttgctt
gccgatttccgtcgcatcattctttga

DBGET integrated database retrieval system