KEGG   Burkholderia plantarii: bpln_1g28480Help
Entry
bpln_1g28480      CDS       T04139                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bpla  Burkholderia plantarii
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bpla00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    bpln_1g28480
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    bpln_1g28480
   00680 Methane metabolism
    bpln_1g28480
Enzymes [BR:bpla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     bpln_1g28480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:3358244..3361348
Genome map
AA seq 1034 aa AA seqDB search
MKSSGSARAARRNAASSNVTAPATTDAPARQRGTTTAAQPAAKTATTKKPAKPAANGAAT
TIANGTATPAGKPAKPAKTPARSGGADPADRLKPKANGRTRDDKDQPLFEDIRYLGRLLG
DVVREQEGDAVFEVVETIRQHAVKFRREDDREAAQALDKMLRKLTPEQTVSVVRAFSYFS
HLANIAEDRHHNRRRRIHALAGSTPQAGTVAYALQTLKAAGDASAEVIRRFFDEALIVPV
LTAHPTEVQRKSILDAQHDIARLLAERDQELTTRERSHNDALLRARVASLWQTRMLRDAR
LTVGDEIDNALSYYRATFLDELPALYADIEEALAEHGLDTRVPAFFQMGSWIGGDRDGNP
NVTAATLEEAIHRQGTVILEHYLEQVHKLGAELSVSDLLVGASDEVKALAAASPDQSPHR
VDEPYRRALIGIYTRIAASARVRLGEGVVAVRSAGRGAPPVRATPYPDAEAFARDLRVLH
ESLVAHHGALLATPRLAPLVRAAETFGFHLASIDLRQSSDIHEAVIAELFARAGVEADYA
ALPEAGKLRVLLAALADPRPLRIPYVDYSELANSELGVLEKAREVRARFGPRAVRNYIIS
HTETVSDLVEVLLLQKETGLLDGTFGAGPADAKHSLMVIPLFETIADLRNAPEIMGEYFA
LPGAAALVARQGGEQEVMLGYSDSNKDGGFLTSNWELYRAELALVELFRSHGTKLRLFHG
RGGTVGRGGGPTYEAILSQPPGTVNGQIRLTEQGEVIASKFSNPEIGRRNLETVVAATLE
ASLLPRNNAPAQLPAFEAAVQTLSDAAIATYRALVYETPGFTDYFFSSTPISEIAELNIG
SRPASRKLQDPKHRRIEDLRAIPWGFSWGQCRLLLTGWYGFGSAFAAYLDGAANDAERAK
RLALLQKMNRTWPFFSHLLSNMDMVLSKVDLAMASRYAELVADKKLRKQVFGRIVAEWER
TTAALAAITGHEARLATNPLLARSIKNRFPYLDPLNHLQVELIKRHRAGDTNARVRRGIH
LTINGIAAGLRNTG
NT seq 3105 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcctccggatcggcgcgcgctgcgcgccgcaatgctgcctcgtccaacgtcacc
gcgccggccacgaccgacgcccccgcgcgccagcgcggcacgaccacggccgcccaaccc
gccgccaagacggcaacgacgaagaaaccggcaaaaccggccgccaacggcgccgcgacg
accatcgccaacggcacggccacgccggccggcaagcccgccaagcccgcgaagacgccg
gcgcgaagcggcggcgcggacccggccgaccggctcaagccgaaagcgaacggccgcacg
cgcgacgacaaggaccagccgctgttcgaggacatccgctatctgggacgcctgctcggc
gacgtggtgcgcgagcaggaaggcgacgccgtgttcgaggtggtcgagacgatccgccag
cacgccgtgaaattccgccgcgaggacgatcgcgaggccgcgcaggcgctcgacaagatg
ctgcgcaagctcacgcccgagcagaccgtgagcgtggtgcgcgcgttcagctacttctcg
catctggccaacatcgccgaggaccgccatcacaaccgccgccgccggatccacgcgctg
gccggctcgacgccgcaggccggcaccgtggcctacgcgctgcagacgctcaaggcggcc
ggcgacgcgtcggccgaggtgatccgccgcttcttcgacgaagcgctgatcgtgccggtg
ctgaccgcgcaccccaccgaagtgcagcgcaagagcatcctcgatgcccagcacgacatc
gcgcggctgctcgccgagcgcgaccaggagctgaccacgcgcgaacgctcacacaatgac
gcgctgctgcgcgcgcgggtggcctcgctgtggcagacccgcatgctgcgcgatgcgcgc
ctcacggtgggcgacgagatcgacaacgcgctgtcctactatcgcgcgacctttctcgac
gagctgccggcgctctacgccgacatcgaggaagcgctcgccgaacacggcctggacacg
cgcgtgccggccttcttccagatgggcagctggatcggcggcgaccgcgacggcaatccg
aacgtcacggccgccacgctcgaggaagcgatccaccgccagggcaccgtgatcctcgaa
cactatctggagcaggtccacaagctcggcgccgagctgtcggtgtcggacctgctggtg
ggcgcgagcgacgaggtcaaggcgctcgcggcggcctcgccggaccagtcgccgcatcgc
gtcgacgagccgtaccgccgcgcgctgatcggcatctacacgcgcatcgccgcgagcgcg
cgcgtgcggctcggcgagggcgtggtggcggtgcgcagcgccgggcgcggcgcgccgccg
gtgcgcgcgacgccgtatccggatgccgaggcgttcgcgcgcgacctgcgcgtgctgcac
gagtcgctcgtcgcccatcacggcgcgctgctcgcgacgccgcgcctcgcgccgctggtg
cgcgcggccgagacgttcggcttccatctcgccagcatcgacctgcgccagagttcggac
atccacgaggccgtgatcgccgagctgttcgcgcgcgccggcgtcgaggccgactacgcg
gcgctgcccgaagccggcaagctgcgcgtgctgctcgccgcgctggccgatccgcgcccg
ctgcggattccctacgtcgactactccgaactcgcgaacagcgaactcggcgtgctcgag
aaggcccgcgaggtgcgcgcgcgcttcggtccgcgcgcggtgcgcaactacatcatctcg
cataccgagacggtctccgatctggtcgaggtgctgctgctgcagaaggaaaccggcctg
ctcgacggcacgttcggtgccggcccggccgacgcgaagcattcgctgatggtgatcccg
ctgttcgagacgatcgccgacctgcgcaacgcgcccgagatcatgggcgagtacttcgcg
ctgccgggcgccgcggcgctcgtcgcgcgccagggcggcgagcaggaggtgatgctcggc
tattcggacagcaacaaggacggcggcttcctgacctcgaactgggagctgtaccgcgcc
gagctcgcgctggtcgagctgttccgctcgcacggcaccaagctgcgcctgttccacggc
cgcggcggcacggtcggccgcggcggcggtccgacctacgaggcgatcctctcgcagccg
cccggcaccgtgaacggccagatccgcctgaccgagcagggcgaggtgatcgcgagcaag
ttctcgaatcccgagatcggccgccgcaacctcgaaacggtggtcgccgcgacgctcgaa
gcctcgctgctgccgcgcaacaacgcgcccgcgcagttgcccgcgttcgaggccgccgtg
cagacgctgtcggacgcggcgatcgccacctatcgcgcgctcgtctacgagacgcccggc
ttcaccgactacttcttctcgtcgacgccgatcagcgagatcgccgagctgaacatcggc
agccggcccgcctcgcgcaagctgcaagatccgaagcaccgccggatcgaggatctgcgc
gcgattccgtggggcttctcgtggggccagtgccggctgctgctgacgggctggtacggc
ttcggcagcgcgttcgcggcctacctcgacggtgccgccaacgacgccgagcgcgccaaa
cgcctcgcgctgctgcagaagatgaaccgcacctggccgttcttctcgcacctgctctcg
aacatggacatggtgctctcgaaggtcgacctggcgatggcctcgcgctacgcggaactc
gtcgccgacaagaagctgcgcaagcaggtgttcggccgcatcgtcgccgaatgggaacgc
accacggccgcgctcgccgcgatcaccggccacgaggcgcggctcgccaccaacccgctg
ctcgcgcgttcgatcaagaaccgcttcccgtacctcgatccgctgaaccacctgcaggtc
gagctgatcaagcgccaccgcgccggcgacaccaacgcgcgcgtgcggcgcgggatccat
ctgaccatcaacgggatcgccgccggcctgcgcaacaccggctga

DBGET integrated database retrieval system