KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0277Help
Entry
BURPS1710b_A0277  CDS       T00289                                 

Definition
(GenBank) AMP-binding domain protein
Organism
bpm  Burkholderia pseudomallei 1710b
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
II:complement(419864..421663)
Genome map
AA seq 599 aa AA seqDB search
MPSNFAEHFENQVLKYGNRSQFVFLHGKPGDSAGEARLGYAQLDARARSIAAWLSACGAA
RRPVLLVYPEGLAFVAAFLGCLYAGAIAVPVPVPADARSVERTRRIVRDAGIALALTPTA
ADAHALANCLAAPGDAVSTVGALRCEATDALEPLDASAWSRPALDASAIAFLQYTSGSTG
EPKGVVVSHRNLLHNEAQIQRVVASDADSVVTGWLPHFHDMGLIGMLLHPLYVGCDCVFM
APSTFLRRPVRWLEAATHYAATITVAPNFAYDLCARAVKREQLGGLDLSALKVALNGAEP
VRAKTIEAFSARFAPVGFDARAFSPCYGMAEVTLLASAGRPAAAPVLLDIDARALERHEA
SLAKPGAEALRVVGSGRAVDLDLRIVDPQTHAVAADGRIGEIWLRGDSVAQGYWRRPDAS
EAAFRARTAAGDGPYLRTGDLGFVRDGELFVTGRLKDLLIVNGRNLYPQDIEDFVRELHP
ALGAGAGAAFSIDADGERVVVVHEIKEARLDDGLSAAALSARIRTALARAFDIAAPSVVL
VPRGGVKRTTSGKVQRGLTRDAFLAARLRVLHEDIQVPVRSLRVAAGEGVAQDASRGAA
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
gtgccgtctaattttgccgaacacttcgaaaatcaagtcttgaagtacgggaatcgcagt
caatttgtttttctacacggaaaacccggtgattcggccggcgaggcgcggctcggctat
gcgcaactggatgcccgcgcgcgatcgatcgccgcgtggctgtcggcgtgcggcgccgcg
cgccggccggttctgctcgtctatcccgaaggcctcgcgtttgtggcggcttttctcggc
tgcctgtatgccggcgcgatcgccgtgccggtgcccgtgcccgcggacgcgcgcagcgtc
gagcgaaccaggcggatcgtccgcgatgcgggcatcgcgcttgcgctgacgccgacggcc
gccgatgcgcacgcgctcgcgaactgcctggccgcgcccggcgatgcggtctccacggtc
ggcgcgctgcgatgcgaggccaccgacgcgctcgagcccctcgatgcgagcgcgtggagc
aggccggcgctcgatgcctcggcgatcgcgttcttgcaatacacgtccggctcgacggga
gagcccaaaggcgtcgtcgtgtcgcatcgtaatctgctgcacaacgaagcgcagattcag
cgtgtcgtggcgagcgacgccgatagcgtcgtgacgggatggctgccgcattttcacgac
atggggctgatcggcatgctgctgcatccgctgtacgtcggctgcgactgcgtgttcatg
gcgccgtccacgttcttgcggcgtcccgttcgatggctggaggccgcgacgcattacgcg
gccacgattacggtcgcgccgaacttcgcgtacgacctgtgcgcgcgcgccgtgaagcgc
gagcaactcggcgggctcgatctgtccgcgctgaaggtcgcgttgaacggcgcggagccg
gttcgcgcgaaaacgatcgaagcgttctcggcgcgtttcgcgccggtcggcttcgatgca
cgggcgttttcgccgtgctacgggatggccgaggtcacgttgctcgcgagcgcgggccgc
ccggcggcggcgcccgtgctgctcgatatcgacgcgcgggcgctcgagcgccatgaggca
tcgttggcgaagcccggtgccgaggcgttgcgcgtcgtgggcagtgggcgcgccgtcgat
ctcgatctgcgcatcgtcgatccgcaaacgcacgccgtggcggccgacgggcgcatcggc
gagatctggctgcgcggcgacagcgtcgcgcaaggctactggcgccgccccgacgcgagc
gaggcggcgttccgggcgcgcacggccgcaggcgacgggccgtatctgcggaccggcgat
ctcggtttcgtgcgggacggggagctgttcgtgaccgggcgcctcaaggacctgctgatc
gtcaacggccgcaacctctatccgcaggacatcgaggatttcgttcgcgagttgcatccc
gcgctcggcgcgggcgcgggcgcggcgttttcgatcgacgcggacggcgaacgcgtcgtc
gtcgtccatgaaatcaaggaggcgcggctcgacgatggcctttcggccgccgcgctgtcc
gctcgcatcaggacggcgctcgcgcgcgcgttcgacatcgcggccccgagcgtcgtgctc
gtgccgcgcggcggcgtgaagcgcacgacgagcggcaaggtgcagcgcggcctcacgcgc
gacgcgtttctggccgcgcggctgcgcgtgctgcacgaggatatccaggtgccggttcgg
tcgttgcgtgtggccgcgggcgagggcgtcgcgcaggatgcctcccggggcgccgcatga

DBGET integrated database retrieval system