KEGG   Burkholderia pseudomallei BPC006: BPC006_I1066Help
Entry
BPC006_I1066      CDS       T02301                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bpq  Burkholderia pseudomallei BPC006
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bpq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BPC006_I1066
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BPC006_I1066
   00680 Methane metabolism
    BPC006_I1066
Enzymes [BR:bpq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BPC006_I1066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
I:complement(1039008..1042082)
Genome map
AA seq 1024 aa AA seqDB search
MRHAPPRRLIAPAVAGPQFPFTRAFPRKSIVKSSGSARATRRNAVSSSSAPAHAEPPARR
AAKPARKLDGAAARPLAPTNAASAKPQGRTREDKDRPLFEDIRYLGRLLGDVVREQEGDA
VFDVVETIRQTAVKFRREDDKAAAQTLEKMLRKLTPEQTVSVVRAFSYFSHLANIAEDRH
HNRRRRIHALAGSAAQAGTVAYALDKLKQAGDASSKTIKQFFEGALIVPVLTAHPTEVQR
KSILDAQHDIARLLAERDQPLTARELAHNEALLRARVTTLWQTRMLRDARLTVADEIENA
LSYYRATFLDELPALYADIEEALAEHGLRARVPAFFQMGSWIGGDRDGNPNVTAATLDEA
ISRQAAVIFEHYLEQVHKLGAELSVSNLLVGASDALKALAAASPDQSPHRVDEPYRRALI
GVYTRLAASARVRLGEGTVPVRSAGRGAAPVRATPYADAEEFAADLRVLTDSLALHHGES
LATPRLAPLMRAAEVFGFHLASIDLRQSSDIHEAVVAELLARGGVEADYAALPEADKLRV
LLAALADPRPLRSPYLDYSDLAKSELGVLERAHAIRAQFGARAVRNYIISHTETVSDLVE
VLLLQKETGLFEGTLGTPHANARNGLMVIPLFETIADLRNASDIMRAFFALPGVGELLAH
QGHEQEVMLGYSDSNKDGGFLTSNWELYRAELALVDLFDERGIKLRLFHGRGGTVGRGGG
PTYQAILSQPPGTVNGQIRLTEQGEVIASKFANPEIGRRNLETVVAATLEATLAPHSNAP
KQLPAFEAAMQTLSDAAMASYRALVYETPGFTDYFFSSTPITEIAELNIGSRPASRKLQD
PKNRKIEDLRAIPWGFSWGQCRLLLTGWYGFGSAVAAYLDGAPDAAERGKRVALLKKMNK
TWPFFANLLSNMDMVLAKTDLAVASRYAQLVADKKLRKHVFERIVAEWHRTADALAEITG
AHARLAANPLLARSIKNRFPYLDPLNHLQVELIKRHRAGDTNARLRRGIHLTINGIAAGL
RNTG
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcatgcgccgccgcgccgcctgatcgcgcccgctgttgctggaccgcagttcccg
ttcactcgtgctttcccaaggaaatcgatcgtgaagtcttccggatcggcgcgcgcgacg
cgccgcaatgctgtctcgtcctcttccgccccggcgcacgccgagccccccgcccgccgc
gccgcgaaacccgcacgcaagctcgacggcgccgccgcgcgcccgctcgcgccgacgaac
gccgcatccgcgaaaccgcaaggccgcacgcgcgaagacaaggaccgcccgctcttcgag
gacattcgctatctcggccgcctgctcggcgacgtcgttcgcgaacaggaaggcgacgcc
gtgttcgacgtcgtcgagacgattcgccagaccgcggtcaagttccgccgcgaggacgac
aaggccgccgcgcagacgctcgagaaaatgctgcgcaagctcacgcccgagcagacggtg
agcgtcgtgcgcgcgttcagctatttctcgcacctcgcgaacatcgccgaggaccgccat
cacaaccgccgccgccgcatccacgcgctcgcgggctccgcggcgcaggcgggcaccgtc
gcgtacgcgctcgacaagctcaagcaggcgggcgacgcgtcgtcgaagacgatcaagcag
ttcttcgaaggcgcgctgatcgtgcccgtgctcaccgcgcacccgaccgaggtgcagcgc
aagagcattctcgacgcgcagcacgacatcgcgcggctgctcgccgagcgcgaccagccg
ctgaccgcgcgcgagctcgcgcacaacgaggcgctgctgcgcgcgcgcgtgacgacgctc
tggcagacccggatgctgcgcgacgcgcgcctgaccgtcgccgatgagatcgagaacgcg
ctgtcgtactaccgcgcgacgttcctcgacgagctgcccgcgctctacgcggacatcgag
gaggcgctcgccgagcacggcctgcgcgcgcgcgtgccggcgttcttccagatgggcagt
tggatcggcggcgaccgcgacggcaacccgaacgtcaccgccgcgacgctcgacgaggcg
atcagccgccaggcggcggtgatcttcgagcattacctcgaacaggtgcacaagctcggc
gcggagctgtccgtgtcgaacctgctcgtcggcgcgagcgacgcgctcaaggcgctcgcc
gccgcgtcgccggaccagtcgccgcaccgcgtcgacgagccgtaccgccgcgcgctgatc
ggcgtctacacgcggctcgcggccagcgcgcgcgtgcggctcggcgagggcacggtgccc
gtgcgcagcgcgggccgcggcgccgcgcccgtgcgcgcgacgccgtacgcggacgcggag
gagttcgccgccgatctgcgcgtgctgaccgattcgctcgcgctgcatcacggcgaatcg
ctcgcgacgccgcgcctcgcgccgctcatgcgcgcggccgaggtgttcggcttccatctc
gcgagcatcgatttgcggcagagctcggacatccatgaagcggtggtcgccgaactgctc
gcgcgcggcggcgtcgaggccgactacgcggcgctgcccgaagcggacaagctgcgcgtg
ctgctcgcggcgctcgcggacccgcggccgctgcgctcgccgtatctcgactactcggac
ctcgcgaagagcgagctcggcgtgctcgagcgcgcgcacgcgatccgcgcgcagttcggc
gcgcgcgcggtgcgcaactacatcatttcgcataccgagacagtgagcgatctcgtcgag
gtgctgctgctgcagaaggaaacgggcctcttcgagggcacgctcggcacgccgcacgcg
aacgcgcgcaacggcctgatggtgattccgctcttcgagacgatcgccgacctgcgcaac
gcgtccgacatcatgcgcgcgttcttcgcgctgccgggcgtgggcgagctgctcgcgcac
cagggccacgagcaggaagtgatgctcggctattcggacagcaacaaggacggcggcttc
ctcacgtcgaactgggagctctatcgcgcggaactggcgctcgtcgatctgttcgacgag
cgcgggatcaagctgcgcctgttccacggccgcggcggcacggtgggacgcggcggcggc
ccgacctatcaggcgatcctgtcgcagccgcccggcacggtaaacggccagatccggctc
accgagcagggcgaggtgatcgcgagcaagttcgcgaacccggagatcggccggcgcaat
ctggagacggtcgtcgccgcgacgctcgaggcgacgctcgcgccgcacagcaacgcgccg
aagcagttgcccgcgttcgaggcggcgatgcagacgctgtcggacgcggcgatggcgtcg
taccgcgcgctcgtctacgagacgcccggcttcaccgactacttcttctcgtcgacgccg
atcaccgagatcgccgagctgaacatcggcagccggcccgcgtcgcgcaagctgcaggat
ccgaagaaccgcaagatcgaggacctgcgcgcgattccgtggggcttctcatggggccag
tgccggctgctgctcaccggctggtacggcttcggcagcgcggtcgccgcgtatctcgac
ggcgcgccggacgcggccgagcgcggcaagcgcgtcgcgctgctgaagaaaatgaacaag
acctggccgttcttcgcgaacctgctgtcgaacatggacatggtgctcgcgaagaccgat
ctcgcggttgcgtcgcgctacgcgcagctcgtcgccgacaagaagctgcgcaagcacgtg
ttcgagcggatcgtcgccgaatggcatcgcacggcggatgcgctcgccgagatcaccggc
gcgcacgcgcggctcgccgcgaatccgcttctcgcgcgctcgatcaagaaccgcttcccg
tacctcgatccgctgaaccacctgcaagtcgagctgatcaagcggcaccgcgcgggcgac
acgaacgcgcggctgcggcgcgggatccatctgacgatcaacgggatcgcggccggcctg
cgcaatacgggctga

DBGET integrated database retrieval system