KEGG   Burkholderia pseudomallei BPC006: BPC006_II1701Help
Entry
BPC006_II1701     CDS       T02301                                 

Definition
(GenBank) AMP-binding domain-containing protein
Organism
bpq  Burkholderia pseudomallei BPC006
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
II:complement(1747978..1749810)
Genome map
AA seq 610 aa AA seqDB search
MRRVQITDGAIVPSNFAEHFENQVLKYGNRSQFVFLHGKPGDSAGEARLGYAQLDARARS
IAAWLSACGAARRPVLLVYPEGLAFVAAFLGCLYAGAIAVPVPVPADARSVERTRRIVRD
AGIALALTPTAADAHALANCLAAPGDAVSTVGALRCEATDALEALDASAWSRPALDASAI
AFLQYTSGSTGEPKGVVVSHRNLLHNEAQIQRVVASDADSVVTGWLPHFHDMGLIGMLLH
PLYVGCDCVFMAPSTFLRRPVRWLEAATHYAATITVAPNFAYDLCARAVKREQLGGLDLS
ALKVALNGAEPVRAKTIEAFSARFAPVGFDARAFSPCYGMAEVTLLASAGRPAAAPVLLD
IDARALERHEASLAKPGAEALRVVGSGRAVDLDLRIVDPQTHAVAADGRIGEIWLRGDSV
AQGYWRRPDASEAAFRARTAAGDGPYLRTGDLGFVRDGELFVTGRLKDLLIVNGRNLYPQ
DIEDFVRELHPALGAGAGAAFSIDADGERVVVVHEIKEARLDDGLSAAALSARIRTALAR
AFDIAAPSVVLVPRGGVKRTTSGKVQRGLTRDAFLAARLRVLHEDIQVPVRSLRVAAGEG
VAQDASRGAA
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgtgtacaaattactgatggagcaatcgtgccgtctaattttgccgaacacttc
gaaaatcaagtcttgaagtacgggaatcgcagtcaatttgtttttctacacggaaaaccc
ggtgattcggccggcgaggcgcggctcggctatgcgcaactggatgcccgcgcgcgatcg
atcgccgcgtggctgtcggcgtgcggcgccgcgcgccggccggttctgctcgtctatccc
gaaggcctcgcgtttgtggcggcttttctcggctgcctgtatgccggcgcgatcgccgtg
ccggtgcccgtgcccgcggacgcgcgcagcgtcgagcgaaccaggcggatcgtccgtgat
gcgggcatcgcgcttgcgctgacgccgacggccgccgatgcgcacgcgctcgcgaactgc
ctggccgcgcccggcgatgcggtctccacggtcggcgcgctgcgatgcgaggccaccgac
gcgctcgaggccctcgatgcgagcgcgtggagcaggccggcgctcgatgcctcggcgatc
gcgttcttgcaatacacgtccggctcgacgggagagcccaaaggcgtcgtcgtgtcgcat
cgtaatctgctgcacaacgaagcgcagattcagcgtgtcgtggcgagcgacgccgatagc
gtcgtgacgggatggctgccgcattttcacgacatggggctgatcggcatgctgctgcat
ccgctgtacgtcggctgcgactgcgtgttcatggcgccgtccacgttcttgcggcgtccc
gttcgatggctggaggccgcgacgcattacgcggccacgattacggtcgcgccgaacttc
gcgtacgacctgtgcgcgcgcgccgtgaagcgcgagcaactcggcgggctcgatctgtcc
gcgctgaaggtcgcgttgaacggcgcggagccggttcgcgcgaaaacgatcgaagcgttc
tcggcgcgtttcgcgccggtcggcttcgatgcacgggcgttttcgccgtgctacgggatg
gccgaggtcacgttgctcgcgagcgcgggccgcccggcggcggcgcccgtgctgctcgat
atcgacgcgcgggcgctcgagcgccatgaggcatcgttggcgaagcccggtgccgaggcg
ttgcgcgtcgtgggcagtgggcgcgccgtcgatctcgatctgcgcatcgtcgatccgcaa
acgcacgccgtggcggccgacgggcgcatcggcgagatctggctgcgcggcgacagcgtc
gcgcaaggctactggcgccgccccgacgcgagcgaggcggcgttccgggcgcgcacggcc
gcaggcgacgggccgtatctgcggaccggcgatctcggtttcgtgcgggacggggagctg
ttcgtgaccgggcgcctcaaggacctgctgatcgtcaacggccgcaacctctatccgcag
gacatcgaggatttcgttcgcgagttgcatcccgcgctcggcgcgggcgcgggcgcggcg
ttttcgatcgatgcggacggcgaacgcgtcgtcgtcgtccatgaaatcaaggaggcgcgg
ctcgacgatggcctttcggccgccgcgctgtccgctcgcatcaggacggcgctcgcgcgc
gcgttcgacatcgcggccccgagcgtcgtgctcgtgccgcgcggcggcgtgaagcgcacg
acgagcggcaaggtgcagcgcggcctcacgcgcgacgcgtttctggccgcgcggctgcgc
gtgctgcacgaggatatccaggtgccggttcggtcgttgcgtgtggccgcgggcgagggc
gtcgcgcaggatgcctcccggggcgccgcatga

DBGET integrated database retrieval system