KEGG   Beta proteobacterium CB: D521_1164Help
Entry
D521_1164         CDS       T02483                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bprc  Beta proteobacterium CB
Brite
Enzymes [BR:bprc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     D521_1164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1147256..1147834)
Genome map
AA seq 192 aa AA seqDB search
MEHTLPQLPYALDALSPFISKETLEFHYGKHHQTYVTNLNNLVKGTEFENASLEDIIKKS
AGGVFNNAAQVWNHTFYWNSMKPNGGGAPTGALADAINAKWGSFDKFKEEFTKCAVGTFG
SGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLMTCDVWEHAYYIDTRNARPKYVENFWN
VVNWDFASKNFA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggaacacacattacctcagttaccttacgcattagatgcgctttcaccattcatctca
aaagaaactctagagtttcactatggtaaacatcatcaaacctatgtaaccaatttgaat
aacttggttaaaggtactgagtttgaaaatgcttccctggaagacatcattaaaaaatca
gctggcggagtttttaataacgcagcccaagtatggaaccacacgttctattggaacagc
atgaagccaaatggcggcggtgctccaactggcgcattggcagatgctattaatgcgaag
tggggttctttcgacaaatttaaagaagagttcacaaaatgtgcagttggtacatttggg
tcaggttgggcttggttggttaagaaggctgacggctccctcgatttagtttcaacaagc
aatgcagctacacctttaactacggacgcaaagcctttgatgacttgtgacgtttgggag
cacgcttactacatcgacactcgcaatgctcgtccaaagtatgtagaaaatttctggaat
gtagtgaactgggattttgctagcaagaattttgcttaa

DBGET integrated database retrieval system