KEGG   Burkholderia pseudomallei K96243: BPSS1274Help
Entry
BPSS1274          CDS       T00203                                 

Definition
(RefSeq) polyketide synthase
Organism
bps  Burkholderia pseudomallei K96243
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:complement(1739251..1741083)
Genome map
AA seq 610 aa AA seqDB search
MRRVQITDGAIVPSNFAEHFENQVLKYGNRSQFVFLHGKPGDSAGEARLGYAQLDARARS
IAAWLSACGAARRPVLLVYPEGLAFVAAFLGCLYAGAIAVPVPVPADARSVERTRRIVRD
AGIALALTPTAADAHALANCLAAPGDAVSTVGALRCEATDALEPLDASAWSRPALDASAI
AFLQYTSGSTGEPKGVVVSHRNLLHNEAQIQRVVASDADSVVTGWLPHFHDMGLIGMLLH
PLYVGCDCVFMAPSTFLRRPVRWLEAATHYAATITVAPNFAYDLCARAVKREQLGGLDLS
ALKVALNGAEPVRAKTIEAFSARFAPVGFDARAFSPCYGMAEVTLLASAGRPAAAPVLLD
IDARALERHEASLAKPGAEALRVVGSGRAVDLDLRIVDPQTHAVAADGRIGEIWLRGDSV
AQGYWRRPDASEAAFRARTAAGDGPYLRTGDLGFVRDGELFVTGRLKDLLIVNGRNLYPQ
DIEDFVRELHPALGAGAGAAFSIDADGERVVVVHEIKEARLDDGLSAAALSARIRTALAR
AFDIAAPSVVLVPRGGVKRTTSGKVQRGLTRDAFLAARLRVLHEDIQVPVRSLRVAAGEG
VAQDASRGAA
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgtgtacaaattactgatggagcaatcgtgccgtctaattttgccgaacacttc
gaaaatcaagtcttgaagtacgggaatcgcagtcaatttgtttttctacacggaaaaccc
ggtgattcggccggcgaggcgcggctcggctatgcgcaactggatgcccgcgcgcgatcg
atcgccgcgtggctgtcggcgtgcggcgccgcgcgccggccggttctgctcgtctatccc
gaaggcctcgcgtttgtggcggcttttctcggctgcctgtatgccggcgcgatcgccgtg
ccggtgcccgtgcccgcggacgcgcgcagcgtcgagcgaaccaggcggatcgtccgcgat
gcgggcatcgcgcttgcgctgacgccgacggccgccgatgcgcacgcgctcgcgaactgc
ctggccgcgcccggcgatgcggtctccacggtcggcgcgctgcgatgcgaggccaccgac
gcgctcgagcccctcgatgcgagcgcgtggagcaggccggcgctcgatgcctcggcgatc
gcgttcttgcaatacacgtccggctcgacgggagagcccaaaggcgtcgtcgtgtcgcat
cgtaatctgctgcacaacgaagcgcagattcagcgtgtcgtggcgagcgacgccgatagc
gtcgtgacgggatggctgccgcattttcacgacatggggctgatcggcatgctgctgcat
ccgctgtacgtcggctgcgactgcgtgttcatggcgccgtccacgttcttgcggcgtccc
gttcgatggctggaggccgcgacgcattacgcggccacgattacggtcgcgccgaacttc
gcgtacgacctgtgcgcgcgcgccgtgaagcgcgagcaactcggcgggctcgatctgtcc
gcgctgaaggtcgcgttgaacggcgcggagccggttcgcgcgaaaacgatcgaagcgttc
tcggcgcgtttcgcgccggtcggcttcgatgcacgggcgttttcgccgtgctacgggatg
gccgaggtcacgttgctcgcgagcgcgggccgcccggcggcggcgcccgtgctgctcgat
atcgacgcgcgggcgctcgagcgccatgaggcatcgttggcgaagcccggtgccgaggcg
ttgcgcgtcgtgggcagtgggcgcgccgtcgatctcgatctgcgcatcgtcgatccgcaa
acgcacgccgtggcggccgacgggcgcatcggcgagatctggctgcgcggcgacagcgtc
gcgcaaggctactggcgccgccccgacgcgagcgaggcggcgttccgggcgcgcacggcc
gcaggcgacgggccgtatctgcggaccggcgatctcggtttcgtgcgggacggggagctg
ttcgtgaccgggcgcctcaaggacctgctgatcgtcaacggccgcaacctctatccgcag
gacatcgaggatttcgttcgcgagttgcatcccgcgctcggcgcgggcgcgggcgcggcg
ttttcgatcgatgcggacggcgaacgcgtcgtcgtcgtccatgaaatcaaggaggcgcgg
ctcgacgatggcctttcggccgccgcgctgtccgctcgcatcaggacggcgctcgcgcgc
gcgttcgacatcgcggccccgagcgtcgtgctcgtgccgcgcggcggcgtgaagcgcacg
acgagcggcaaggtgcagcgcggcctcacgcgcgacgcgtttctggccgcgcggctgcgc
gtgctgcacgaggatatccaggtgccggttcggtcgttgcgtgtggccgcgggcgagggc
gtcgcgcaggatgcctcccggggcgccgcatga

DBGET integrated database retrieval system