KEGG   Burkholderia pseudomallei NAU35A-3: BBU_4779Help
Entry
BBU_4779          CDS       T03476                                 

Definition
(GenBank) AMP-binding enzyme family protein
Organism
bpsa  Burkholderia pseudomallei NAU35A-3
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2:1712663..1714423
Genome map
AA seq 586 aa AA seqDB search
MKYGNRSQFVFLHGKPGDSAGEARLGYAQLDARARSIAAWLSACGAARRPVLLVYPEGLA
FVAAFLGCLYAGAIAVPVPVPADARSVERTRRIVRDAGIALALTPTAADAHALANCLAAP
GDAVSTVGALRCEATDALEPLDASAWSRPALDASAIAFLQYTSGSTGEPKGVVVSHRNLL
HNEAQIQRVVASDADSVVTGWLPHFHDMGLIGMLLHPLYVGCDCVFMAPSTFLRRPVRWL
EAATHYAATITVAPNFAYDLCARAVKREQLGGLDLSALKVALNGAEPVRAKTIEAFSARF
APVGFDARAFSPCYGMAEVTLLASAGRPAAAPVLLDIDARALERHEASLAKPGAEALRVV
GSGRAVDLDLRIVDPQTHAVAADGRIGEIWLRGDSVAQGYWRRPDASEAAFRARTAAGDG
PYLRTGDLGFVRDGELFVTGRLKDLLIVNGRNLYPQDIEDFVRELHPALGAGAGAAFSID
ADGERVVVVHEIKEARLDDGLSAAALSARIRTALARAFDIAAPSVVLVPRGGVKRTTSGK
VQRGLTRDAFLAARLRVLHEDIQVPVRSLRVAAGEGVAQDAFRGAA
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtacgggaatcgcagtcaatttgtttttctacacggaaaacccggtgattcggcc
ggcgaggcgcggctcggctatgcgcaactggatgcccgcgcgcgatcgatcgccgcgtgg
ctgtcggcgtgcggcgccgcgcgccggccggttctgctcgtctatcccgaaggcctcgcg
tttgtggcggcttttctcggctgcctgtatgccggcgcgatcgccgtgccggtgcccgtg
cccgcggacgcgcgcagcgtcgagcgaaccaggcggatcgtccgcgatgcgggcatcgcg
cttgcgctgacgccgacggccgccgatgcgcacgcgctcgcgaactgcctggccgcgccc
ggcgatgcggtctccacggtcggcgcgctgcgatgcgaggccaccgacgcgctcgagccc
ctcgatgcgagcgcgtggagcaggccggcgctcgatgcctcggcgatcgcgttcttgcaa
tacacgtccggctcgacgggagagcccaaaggcgtcgtcgtgtcgcatcgtaatctgctg
cacaacgaagcgcagattcagcgtgtcgtggcgagcgacgccgatagcgtcgtgacggga
tggctgccgcattttcacgacatggggctgatcggcatgctgctgcatccgctgtacgtc
ggctgcgactgcgtgttcatggcgccgtccacgttcttgcggcgtcccgttcgatggctg
gaggccgcgacgcattacgcggccacgattacggtcgcgccgaacttcgcgtacgacctg
tgcgcgcgcgccgtgaagcgcgagcaactcggcgggctcgatctgtccgcgctgaaggtc
gcgttgaacggcgcggagccggttcgcgcgaaaacgatcgaagcgttctcggcgcgtttc
gcgccggtcggcttcgatgcacgggcgttttcgccgtgctacgggatggccgaggtcacg
ttgctcgcgagcgcgggccgcccggcggcggcgcccgtgctgctcgatatcgacgcgcgg
gcgctcgagcgccatgaggcatcgttggcgaagcccggtgccgaggcgttgcgcgtcgtc
ggcagtgggcgcgccgtcgatctcgatctgcgcatcgtcgatccgcaaacgcacgccgtg
gcggccgacgggcgcatcggcgagatctggctgcgcggcgacagcgtcgcgcaaggctac
tggcgccgccccgacgcgagcgaggcggcgttccgggcgcgcacggccgcaggcgacggg
ccgtatctgcggaccggcgatctcggtttcgtgcgggacggggagctgttcgtgaccggg
cgcctcaaggatctgctgatcgtcaacggccgcaacctctatccgcaggacatcgaggat
ttcgttcgcgagttgcatcccgcgctcggcgcgggcgcgggcgcggcgttttcgatcgac
gcggacggcgaacgcgtcgtcgtcgtccatgaaatcaaggaggcgcggctcgacgatggc
ctttcggccgccgcgctgtccgctcgcatcaggacggcgctcgcgcgcgcgttcgacatc
gcggccccgagcgtcgtgctcgtgccgcgcggcggcgtgaagcgcacgacgagcggcaag
gtgcagcgcggcctcacgcgcgacgcgtttctggccgcgcggctgcgcgtgctgcacgag
gatatccaggtgccggttcggtcgttgcgtgtggccgcgggcgagggcgtcgcgcaggat
gccttccggggcgccgcatga

DBGET integrated database retrieval system