KEGG   Burkholderia pseudomallei MSHR520: BBX_3729Help
Entry
BBX_3729          CDS       T03163                                 

Definition
(GenBank) AMP-binding enzyme family protein
Organism
bpsd  Burkholderia pseudomallei MSHR520
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2:complement(252488..254248)
Genome map
AA seq 586 aa AA seqDB search
MKYGNRSQFFFLHGKPGDSASEARLGYAQLDARARSIAAWLSACGAARRPVLLVYPEGLA
FVAAFLGCLYAGAIAVPVPVPADARSVERTRRIVRDAGIALALTPTAADAHALANCLAAP
GDAVSTVGALRCEATDALEALDASAWSRPALDASAIAFLQYTSGSTGEPKGVVVSHRNLL
HNEAQIQRVVASDADSVVTGWLPHFHDMGLIGMLLHPLYVGCDCVFMAPSTFLRRPVRWL
EAATHYAATITVAPNFAYDLCARAVKREQLGGLDLSALKVALNGAEPVRAKTIEAFSARF
APVGFDARAFSPCYGMAEVTLLASAGRPAAAPVLLDIDARALERHEASLAKPGAEALRVV
GSGRAVDLDLRIVDPQTHAVAADGRIGEIWLRGDSVAQGYWRRPDASEAAFRARTAAGDG
PYLRTGDLGFVRDGELFVTGRLKDLLIVNGRNLYPQDIEDFVRELHPALGAGAGAAFSID
ADGERVVVVHEIKEARLDDGLSAAALSARIRTALARAFDIAAPSVVLVPRGGVKRTTSGK
VQRGLTRDAFLAARLRVLHEDIQVPVRSLRVAAGEGVAQDASRGAA
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtacgggaatcgcagtcaatttttttttctacacggaaaacccggtgattcggcc
agcgaggcgcggctcggctatgcgcaactggatgcccgcgcgcgatcgatcgccgcgtgg
ctgtcggcgtgcggcgccgcgcgccggccggttctgctcgtctatcccgaaggcctcgcg
tttgtggcggcttttctcggctgcctgtatgccggcgcgatcgccgtgccggtgcccgtg
cccgcggacgcgcgcagcgtcgagcgaaccaggcggatcgtccgtgatgcgggcatcgcg
cttgcgctgacgccgacggccgccgatgcgcacgcgctcgcgaactgcctggccgcgccc
ggcgatgcggtctccacggtcggcgcgctgcgatgcgaggccaccgacgcgctcgaggcc
ctcgatgcgagcgcgtggagcaggccggcgctcgatgcctcggcgatcgcgttcttgcaa
tacacgtccggctcgacgggagagcccaaaggcgtcgtcgtgtcgcatcgtaatctgctg
cacaacgaagcgcagattcagcgtgtcgtggcgagcgacgccgatagcgtcgtgacggga
tggctgccgcattttcacgacatggggctgatcggcatgctgctgcatccgctgtacgtc
ggctgcgactgcgtgttcatggcgccgtccacgttcttgcggcgtcccgttcgatggctg
gaggccgcgacgcattacgcggccacgattacggtcgcgccgaacttcgcgtacgacctg
tgcgcgcgcgccgtgaagcgcgagcaactcggcgggctcgatctgtccgcgctgaaggtc
gcgttgaacggcgcggagccggttcgcgcgaaaacgatcgaagcgttctcggcgcgtttc
gcgccggtcggcttcgatgcacgggcgttttcgccgtgctacgggatggccgaggtcacg
ttgctcgcgagcgcgggccgcccggcggcggcgcccgtgctgctcgatatcgacgcgcgg
gcgctcgagcgccatgaggcatcgttggcgaagcccggtgccgaggcgttgcgcgtcgtc
ggcagtgggcgcgccgtcgatctcgatctgcgcatcgtcgatccgcaaacgcacgccgtg
gcggccgacgggcgcatcggcgagatctggctgcgcggcgacagcgtcgcgcaaggctac
tggcgccgccccgacgcgagcgaggcggcgttccgggcgcgcacggccgcaggcgacggg
ccgtatctgcggaccggcgatctcggtttcgtgcgggacggggagctgttcgtgaccggg
cgcctcaaggacctgctgatcgtcaacggccgcaacctctatccgcaggacatcgaggat
ttcgttcgcgagttgcatcccgcgctcggcgcgggcgcgggcgcggcgttttcgatcgac
gcggacggcgaacgcgtcgtcgtcgtccatgaaatcaaggaggcgcggctcgacgatggc
ctttcggccgccgcgctgtccgctcgcatcaggacggcgctcgcgcgcgcgttcgacatc
gcggccccgagcgtcgtgctcgtgccgcgcggcggcgtgaagcgcacgacgagcggcaag
gtgcagcgcggcctcacgcgcgacgcgtttctggccgcgcggctgcgcgtgctgcacgag
gatatccaggtgccggttcggtcgttgcgtgtggccgcgggcgagggcgtcgcgcaggat
gcctcccggggcgccgcatga

DBGET integrated database retrieval system