KEGG   Burkholderia pseudomallei HBPUB10134a: DR55_4013Help
Entry
DR55_4013         CDS       T03422                                 

Definition
(GenBank) AMP-binding enzyme family protein
Organism
bpsh  Burkholderia pseudomallei HBPUB10134a
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2:718558..720318
Genome map
AA seq 586 aa AA seqDB search
MKYGNRSQFVFLHGKPGDSAGEARLGYAQLDARARSIAAWLSACGAARRPVLLVYPEGLA
FVAAFLGCLYAGAIAVPVPVPADARSVERTRRIVRDAGIALALTPTAADAHALANCLAAP
GDAVSTVGALRCEATDALEALDASAWSRPALDASAIAFLQYTSGSTGEPKGVVVSHRNLL
HNEAQIQRVVASDADSVVTGWLPHFHDMGLIGMLLHPLYVGCDCVFMAPSTFLRRPVRWL
EAATHYAATITVAPNFAYDLCARAVKREQLGGLDLSALKVALNGAEPVRAKTIEAFSARF
APVGFDARAFSPCYGMAEVTLLASAGRPAAAPVLLDIDARALERHEASLAKPGAEALRVV
GSGRAVDLDLRIVDPQTHAVAADGRIGEIWLRGDSVAQGYWRRPDASEAAFRARTAAGDG
PYLRTGDLGFVRDGELFVTGRLKDLLIVNGRNLYPQDIEDFVRELHPALGAGAGAAFSID
ADGERVVVVHEIKEARLDDGLSAAALSARIRTALARAFDIAAPSVVLVPRGGVKRTTSGK
VQRGLTRDAFLAARLRVLHEDIQVPVRSLRVAAGEGVAQDASRGAA
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtacgggaatcgcagtcaatttgtttttctacacggaaaacccggtgattcggcc
ggcgaggcgcggctcggctatgcgcaactggatgcccgcgcgcgatcgatcgccgcgtgg
ctgtcggcgtgcggcgccgcgcgccggccggttctgctcgtctatcccgaaggcctcgcg
tttgtggcggcttttctcggctgcctgtatgccggcgcgatcgccgtgccggtgcccgtg
cccgcggacgcgcgcagcgtcgagcgaaccaggcggatcgtccgtgatgcgggcatcgcg
cttgcgctgacgccgacggccgccgatgcgcacgcgctcgcgaactgcctggccgcgccc
ggcgatgcggtctccacggtcggcgcgctgcgatgcgaggccaccgacgcgctcgaggcc
ctcgatgcgagcgcgtggagcaggccggcgctcgatgcctcggcgatcgcgttcttgcaa
tacacgtccggctcgacgggagagcccaaaggcgtcgtcgtgtcgcatcgtaatctgctg
cacaacgaagcgcagattcagcgtgtcgtggcgagcgacgccgatagcgtcgtgacggga
tggctgccgcattttcacgacatggggctgatcggcatgctgctgcatccgctgtacgtc
ggctgcgactgcgtgttcatggcgccgtccacgttcttgcggcgtcccgttcgatggctg
gaggccgcgacgcattacgcggccacgattacggtcgcgccgaacttcgcgtacgacctg
tgcgcgcgcgccgtgaagcgcgagcaactcggcgggctcgatctgtccgcgctgaaggtc
gcgttgaacggcgcggagccggttcgcgcgaaaacgatcgaagcgttctcggcgcgtttc
gcgccggtcggcttcgatgcacgggcgttttcgccgtgctacgggatggccgaggtcacg
ttgctcgcgagcgcgggccgcccggcggcggcgcccgtgctgctcgatatcgacgcgcgg
gcgctcgagcgccatgaggcatcgttggcgaagcccggtgccgaggcgttgcgcgtcgtg
ggcagtgggcgcgccgtcgatctcgatctgcgcatcgtcgatccgcaaacgcacgccgtg
gcggccgacgggcgcatcggcgagatctggctgcgcggcgacagcgtcgcgcaaggctac
tggcgccgccccgacgcgagcgaggcggcgttccgggcgcgcacggccgcaggcgacggg
ccgtatctgcggaccggcgatctcggtttcgtgcgggacggggagctgttcgtgaccggg
cgcctcaaggacctgctgatcgtcaacggccgcaacctctatccgcaggacatcgaggat
ttcgttcgcgagttgcatcccgcgctcggcgcgggcgcgggcgcggcgttttcgatcgat
gcggacggcgaacgcgtcgtcgtcgtccatgaaatcaaggaggcgcggctcgacgatggc
ctttcggccgccgcgctgtccgctcgcatcaggacggcgctcgcgcgcgcgttcgacatc
gcggccccgagcgtcgtgctcgtgccgcgcggcggcgtgaagcgcacgacgagcggcaag
gtgcagcgcggcctcacgcgcgacgcgtttctggccgcgcggctgcgcgtgctgcacgag
gatatccaggtgccggttcggtcgttgcgtgtggccgcgggcgagggcgtcgcgcaggat
gcctcccggggcgccgcatga

DBGET integrated database retrieval system