KEGG   Basilea psittacipulmonis: IX83_01755Help
Entry
IX83_01755        CDS       T03226                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
bpsi  Basilea psittacipulmonis
Pathway
bpsi00020  Citrate cycle (TCA cycle)
bpsi00270  Cysteine and methionine metabolism
bpsi00620  Pyruvate metabolism
bpsi00630  Glyoxylate and dicarboxylate metabolism
bpsi00680  Methane metabolism
bpsi01100  Metabolic pathways
bpsi01110  Biosynthesis of secondary metabolites
bpsi01120  Microbial metabolism in diverse environments
bpsi01130  Biosynthesis of antibiotics
bpsi01200  Carbon metabolism
Module
bpsi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpsi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bpsi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bpsi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IX83_01755
   00620 Pyruvate metabolism
    IX83_01755
   00630 Glyoxylate and dicarboxylate metabolism
    IX83_01755
  Energy metabolism
   00680 Methane metabolism
    IX83_01755
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    IX83_01755
Enzymes [BR:bpsi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     IX83_01755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C Lipase_GDSL_2 Enterotoxin_b
Motif
Other DBs
NCBI-ProteinID: AIL32204
UniProt: A0A077DC29
LinkDB All DBs
Position
complement(371722..372705)
Genome map
AA seq 327 aa AA seqDB search
MKSPVRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLEIPDERAQKALKGVMMELD
DCAFPLLAGLEGFSDPELAFKDADYALLVGSRPRGPGMERKDLLEVNAKIFIEQGRALNK
VASRNVKVLAVGNPANTNAYIAGVSAPDLPRKNFTAMVRLDHNRALTQVANKAGVKVADI
EKLCVWGNHSPTMYPDISHATANGKPLKGLVNDDAWIKDYFIPTVGKRGAAIIEARGLSS
AASAANAAIDHMRDWALGTNGKWVTMGVPSDGSYGIPEGIVYGFPVVCKDGEYEIVQGLD
IDAFSRERLDHTLAELEEEKAGVSGLL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctcctgtacgtgtcgccgttactggtgctgctggtcaaattggctatgcttta
ttgttccgtatcgcttctggcgaaatgcttggaaaagatcaacccgttattcttcaatta
ctagaaatccctgatgagcgtgcccaaaaagctcttaaaggcgtgatgatggaattggat
gattgtgcattccctctattagcgggtcttgagggatttagcgatcctgaattggcgttc
aaagatgcggattatgctttattagtgggttctagaccacgtggtcctggcatggaacgt
aaagatttgttggaagtaaatgctaagatttttattgaacaaggtcgtgcattgaacaaa
gtagctagccgcaatgtcaaagtattggcagtcggtaacccagccaatacaaacgcttat
atcgcaggcgtatcggctcctgatcttcctcgtaagaatttcacagccatggtacgttta
gaccacaaccgtgctttaactcaagttgccaataaagctggcgttaaagtggctgatatt
gaaaaactttgtgtttggggtaaccactctcctaccatgtatccagatatctctcatgcg
acagcaaatggaaaaccgctaaaaggcttagtaaacgatgatgcttggatcaaagattac
tttattccaactgtaggcaaacgtggtgctgccatcatcgaagcacgtggtttatcatca
gcagcgtcagccgctaatgcagcgattgaccatatgcgtgattgggccttaggcactaac
ggaaaatgggtaaccatgggtgtaccatctgatggttcatatggcattcctgaaggtatt
gtgtatggattcccagtggtttgtaaagacggtgaatacgagattgtacaaggtctagac
atcgatgcattcagccgtgaacgcctcgaccacactttggctgaactagaagaagaaaaa
gcaggggtcagcggtcttttataa

DBGET integrated database retrieval system