KEGG   Burkholderia pseudomultivorans: WS57_26015Help
Entry
WS57_26015        CDS       T04870                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bpsl  Burkholderia pseudomultivorans
Pathway
bpsl00020  Citrate cycle (TCA cycle)
bpsl00310  Lysine degradation
bpsl00380  Tryptophan metabolism
bpsl01100  Metabolic pathways
bpsl01110  Biosynthesis of secondary metabolites
bpsl01120  Microbial metabolism in diverse environments
bpsl01130  Biosynthesis of antibiotics
bpsl01200  Carbon metabolism
Module
bpsl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpsl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpsl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WS57_26015 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    WS57_26015 (sucA)
   00380 Tryptophan metabolism
    WS57_26015 (sucA)
Enzymes [BR:bpsl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     WS57_26015 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AOI92166
UniProt: A0A132ERZ0
LinkDB All DBs
Position
1:2970762..2973626
Genome map
AA seq 954 aa AA seqDB search
MSDVMKQFQLNSYLFGGNASYVEELYDAYLDNPASVPENWREYFDALQNVPATDGSNAND
VAHHPIVESFAQRAKANAFIPRESGTNLATARKQVHVQSLISAYRFLGSQWANLDPLKRR
ERPAIPELEPAFYDFSEADLDQTFSASNLYFGFDQASLRDIVKGLRDTYCGTIGAEYMYI
SDPEQKRWWQERLESIRATPNFSVDKKKHILNRLTAAEGLERYLHTKYVGQKRFSLEGGE
SFIAAMDEVVQHAGKKGVQEIVIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAG
DVKYHKGFSSDVSTEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDEDGLQVLPVQ
IHGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDARSTLYCTDVVK
MIEAPVLHVNGDDPEAVVLATQIAIDYRMQFHKDVVIDIVCFRKLGHNEQDTPAVTQPLM
YKKIAQHPGTRALYAEKLVQQGVITAEDADGYVKAYRKAMDDGHHTVDPVLSNYKSKYAV
DWVPFLNRKWTDAADTAVPLAELKRLGERITTIPENFKVHPLVERVINDRRNMARGDQPL
DWGMGEHLAFASLVASGYSVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNIAE
GQAKFTVIDSVLSEEAVLGFEYGYSTAEPNTLVLWEAQFGDFVNGAQVVIDQFISSGEVK
WGRVSGLTMLLPHGYEGQGPEHSSTRIERFLQLCADHNMQVVQPTTPAQIFHLLRRQMIR
LFRKPLIVATPKSLLRHKEAVSDLSELAKGSFQPVLGETDGGIDAKKVKRVLVCSGRVYY
DLVAHRREAKANDVAIIRIEQLYPFAHKQFEAEMKKYENATEVVWVQDEPQNQGPWFYVE
HHLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALIEGAFGRLKSASIAK
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtcatgaagcagtttcagctgaactcctatttgttcggcggcaatgcttcg
tacgtagaagaactgtacgatgcatatctcgataatccggcgtcagtgcccgagaactgg
cgagagtatttcgacgcgttgcagaacgttcctgcaacggacggttcgaacgccaacgac
gtggcgcatcacccgatcgtcgaatcgttcgcccagcgcgccaaggccaatgccttcatc
ccgcgcgaaagcggcaccaatctggctactgcgcgcaagcaggtccacgtccagtccctc
atcagcgcctaccgcttcctcggctcgcaatgggccaatcttgatccgctgaagcgccgc
gagcgtcccgccatccccgaactcgaacctgcgttctacgacttctccgaggccgacctc
gaccagacgttcagcgcgagcaacctgtatttcggcttcgaccaggcttcgctgcgcgac
atcgtcaagggtctgcgcgacacgtactgcggcacgatcggcgccgagtacatgtacatc
agcgatccggaacagaagcgctggtggcaggagcgcctcgaatcgattcgcgcgacgccg
aacttctcggtcgacaagaagaagcacatcctgaaccgcctgacggctgcggaaggcctc
gagcgctatctgcacaccaagtacgtcggccagaagcgcttctcgctcgaaggcggcgaa
agcttcatcgcggcgatggacgaagtcgtccagcacgcgggcaagaagggcgtccaggaa
atcgtcatcggcatggcccaccgcggccgcctgaacgtgctcgtgaacacgctcggcaag
atgccggctgacctgttcgccgaattcgaaggcaagcacgtcgacgacctgccggccggc
gacgtgaagtaccacaagggcttctcgtcggacgtgtcgacggaaggcggcccggtccac
ctgtcgctcgcgttcaacccgtcgcacctcgaaatcgtcaacccggtggtcgaaggttcg
gcgaaggcgcggatggaccgtcgcggcgacgaagacggcctgcaggtgctgccggtgcag
atccacggcgatgcggccttcgcgggccagggcgtcgtgatggagacgctgaacctcgcg
cagacgcgcggttacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggc
ttcacgacgtccgacccgcgcgacgcgcgctcgacgctgtactgtaccgacgtcgtcaag
atgatcgaggcaccggtgctgcacgtgaacggcgacgatccggaagccgtggtcctcgcg
acgcagatcgcgatcgactaccggatgcagttccacaaggatgtcgtgatcgacatcgtc
tgcttccgcaagctgggccacaacgagcaggacacgccggcggtcacgcagccgctgatg
tacaagaagatcgcgcagcacccgggcacccgtgcgctgtacgccgagaagctcgtgcag
cagggcgtgatcaccgcggaagacgccgacggctacgtgaaggcgtaccgcaaggcgatg
gacgacggccatcacacggtcgatccggtcctgtcgaactacaagagcaagtacgcggtc
gactgggtgccgttcctgaaccgcaagtggacggacgcagccgatacggccgtgccgctc
gccgaactgaagcgcctcggcgaacgcatcacgacgatcccggaaaacttcaaggttcac
ccgctcgtcgagcgcgtgatcaacgaccgccgcaacatggcgcgcggcgaccagccgctc
gactggggcatgggcgaacacctggcattcgcgtcgctcgtcgcatcgggctactcggtg
cgcctgacgggccaggactcgggccgcggcacgttcacgcaccgtcacgcggtgctgcat
gaccagaaccgcgagcgctggaacgacggcacgtacgtgccgctgcagaacatcgccgaa
ggccaggcgaagttcacggtgatcgactcggtgctgtcggaagaggcagtgctgggcttc
gaatacggctactcgaccgccgagccgaacacgctcgtgctgtgggaagcgcagttcggc
gacttcgtcaacggcgcgcaggtcgtgatcgaccagttcatctcgtcgggcgaagtgaag
tggggccgcgtgtcgggcctgacgatgctgctgccgcacggctacgaaggccagggtccg
gagcactcgtcgacccgcatcgagcgtttcctgcagctgtgcgcggatcacaacatgcag
gtcgtccagccgacgacgccggcgcagatcttccacctgctgcgtcgccagatgatccgc
ctgttccgcaagccgctgatcgtcgcgacgccgaagtcgctgctgcgtcacaaggaagcg
gtgtcggacctgtcggaactcgcgaagggttcgttccagccggtgctgggcgaaaccgac
ggcggcatcgacgcgaagaaggtcaagcgcgtgctggtctgctcgggccgcgtgtactac
gacctcgtcgcgcatcgccgcgaagcgaaggcgaacgacgtcgcgatcatccgtatcgaa
cagctgtatccgttcgcgcacaagcagttcgaagctgaaatgaagaagtacgagaacgcg
acggaagtggtctgggtgcaggacgagccgcagaaccagggcccctggttctacgtcgag
caccacctgaaggaaggcatgaaggaaggacagaagctggcatacagcggtcgtccggct
tcggcctcgccggcggtcggctactacgcgaagcactacgagcagcagaaggccctgatc
gaaggtgctttcggccgcctgaagagcgcatcgatcgcgaaataa

DBGET integrated database retrieval system