KEGG   Burkholderia pseudomallei MSHR511: BBQ_1443Help
Entry
BBQ_1443          CDS       T03012                                 

Definition
(GenBank) amino acid adenylation domain protein
Organism
bpsm  Burkholderia pseudomallei MSHR511
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:1610690..1620943
Genome map
AA seq 3417 aa AA seqDB search
MTTTDLDKMQQAGTIVHVLQRHAGERPDALAYHFIESPETGAGPQLTYRQLDERARRVAA
YLRQHANENDRVLLFFPPGLEYIAAFLGCLYAGVIAVPLYPPRRGEKLDRIAHVVRDCGA
RFAFGDGEAVAKASEWFSGEMGRALSAAISLLSIDAAADVPPIPASDYRRTPADVAFLQY
TSGSTGEPKGVAVSHGNLIANQIAIAAGFGSRDDDVCLNWLPLYHDMGLIGTTLHPLFYG
YPSHIMSPTAFIKDPLSWLENITRFRATVAGGPDFGYRLCAEHAARSPERVAALDLSSWR
IAFNGAEPVQAESMRRFAQIYARARFDPRAFYPCYGLAEATLFVTGGAPGGAFHARAADR
FALTLGRLEPQGGAASVELVSSGRCAAGHELRIVNDLREAAQGEIGEIWVRGPSIPSGYW
NKDAVNADVFRARLAAPDPAPSGFLRTGDLGCVVDGELFVTGRSKDVVIVNGRNYYPQDL
EAAAGASDPALREGCTAAFSIDGEGDARVVVVQEVDRRFAKTIDVDAAARAIRTAISRAC
DVAVDEIVFIQPASIPKTSSGKIRRRETRARYLDGTLLLVGRDVRSASGAGAASDQDLDA
LWPQAARSGAVPADEHAARIVLALRRAVAALTGQTPEAIGADLPLAGAGLNSIGVVRLQG
LIEKHLGAQVGLDDLFGASSIAELGAQIARTDTAAPAAPRATAGAKEREFALSPNQQQLW
FLHQFDPDRHDYNLALLIECRPALASDALEASVARACARHPILRTRYRAEDSRNVQTVEP
TPCVDFAEIDPQGLDDAALIERFGDEALRPFDLERGAALRIRVAQRDGGRTWLLVNLHHI
ASDFWSMSQLVEEIVSDASGGEPIADPERDYQDWCRERDAYTGSAAALADRQYWRSVLGE
NRADSALASVFEPSAQRAEGAADGAPRPVNFRIGETLAKRVEAFARRSGRTLNAVYLAAF
QLLLHRRGAAEHLAIGTLAAGRTHWAYARTQGYFVNPLALHTAYRDDTTFAAFLSQSADN
LTAAIAHQAYPFAHLVNEHASKNRAGRHPFFQALFVMQQSSGRRGTEAFAIKGVAAEIEI
GSITARSLPLRSAPSQFDLALTMAPAARGIEAMLEYGETLATRDQVAAFADEYLQLLDAV
LDAADAPLHTIEPKAAPAAIDAPAAERAADLPAAAVPLAQCDSLIEGFEQQVRSGPQRVA
LTYGESSLTYRELDERATQLARALAPRMRADGPTTAALLLHRGVDVVVSILAILKAGGTY
VPLDPHSPAERLGFILEDAQPSVLVTSTAFGDLLGKLPSVEGRTVLLVDALAEPARDGAH
AADRAPQAARALRRDDCAYVIFTSGTTGRPKGVQVTHDNVLRLFTSSEPEYRFDERDVWT
LFHSIAFDISVWEMWGALLYGGRIVGVPYEISRSPDEFRALCARERVTVLNQTPSAFKYF
IAADLRRDDRLSALRLVIFGGETLVFGSLKDWFRKYGDAQPLLVNMYGITEITVHGTYRP
VTLADLDAPGSMIGLPLRDLSIVLLDEDRKPVVDGEVGEIYVGGRGVALGYLRNETLTRE
RFVDLDIEPGAGVGRYYKSGDLARKVGDADYEYLGRKDQQVKINGFRIELGEIEAALTRF
DGIRDAVTLASKPHKPRNVVAPASADGGAGAITEIRQLIRAASTPQPDDEQTRLVSYIVC
DALPDVQALYRHLSERIPDYMMPSAVLPIDAIPLNQNGKVDAKALMQRADGAIPLRAAYV
APRTDEEKLLCKLYAEVLEKPRVGANDGFFELGGDSIRIIQLRSRALKAGLQISVQDVFR
LQTPAALAAVTKISAQLAERPRVAAFAQTSDAERRQLPEDAVDAYPLARLQEGLLFHSQF
GDDIAMYCDIFEFRLRARYDLRAFEQALAALIERHPIFRTSFHLGEFERPLQIVHAHSAP
VVDVFDYRDVDDARRKQRYEAWLDGEKRRPYDVARAPLLRFSLHRWTDDEFVFTMSFHDA
LLDGWSESSAVSEILRNYVSLVGDGALPQLPELHTRFSDYVSLEQETVADPAVRAFWEAE
LEDFRPTRLAYLQETHADAGRNPMRFYAVDVPAALSNDLKALAARLGVSLKHVLLAAHAS
VMSFVSGESDVVLAVESNGRLEDGDGERVLGTHLNVVPWRVQLGGDTWSELVKRIHDKES
ALQAYRRYPYQEIQHLKGNEPLFDVSFNYTHFHVYEELEQLAGVSVVDAKAYIQTHFALR
VEFNQDPFTKHLTLDLEANLDALPLERLVAIGGYFRRALEAIVASPDEHFAARTLLGDDE
AAVERRAAAGALVERPAGAPGLYVATFERRASEWPDRIAAVDASRSIGYRALLDASRTAA
AQLRARGVRPGDIVALLADRSIDYLTAILGLWRVGAAFVPLPDGPAERIDALLERARAAH
LVVARGHASVAERLRSGAARIALDALAEPADAAALRAPAFEACADTLAYVIFTSGSTGEP
KGVMIDHGGMINHIEAKIEDLGIGAADIVSQDAAATFDICVWQFCAPLIAGAQVRIYDDA
VAKDPARLLERVVADGVSILEVSPSVLSTMLLVHAAQPDAPALALGASALRWVVSSGETL
QPSLVHQLRAVHPRVGILNMWGATETSDDCTHYKVPFDLDARAPKISIGRPIKNAAVYVL
DPWGRTVPAGTPGELYVGGVCVGLGYLNDPQRTAAAYSSREAAFAGSHRLYRSGDRGWRA
ANGELFFIGRRDNQVKIRGHRIEIGEVEAALNREPSVQEAVVLALPDATGQLSLAAWAVP
ADLRALEGAGATSAWASALRKQVKLGLPAYMIPDVIVALDRLPKNVNGKVDRKALALPDD
AQTCAQLEVVAPGNDVEAFVVDLFRQILKRPAVSADWSFFDIGGNSLLATQVVSRARRHF
RIDLPIRALFEHDTAISFAAAIAAAQAEALREDTIAPQGRPEHIPLSFNQERLWFLDKID
ASQRAYGSHFALRIDGPLDVDTLAWVLQRMTDRHEILRTRFATLDNQPCQVVAPEMTFPL
AVKDLSGERASSAREALDSAIESELSRPFRLDALPLCSATIYRLSDNEHVLLWRNHHIIG
DGWSAGVILREIEQLYPARRDGRAAELPPLPIQFADYAIWQRRFAQSEPFKRQLDFWRGY
LDGYAGVLQLPTDFERPDQPTFDGRRIAVALPAGLVERVHAFSRASKSTVFVFLQTALGL
LLSRYAKQGDLVLGTAVANRSRIETEPLIGFLTNTLPVRQRFDPSASFAAHLARVRDDVL
NVFDSQDVTFAHLVQMALRERDPRVNPLVQVMFVLQNEDLSMPQVDGLRIAPVELDRAAS
ILDLLFDLREEGGAIVGHVEYNVNLFRESTIRLLWAHLSNLIGAIVDGGDVPVSQLSSLG
DEERRLLTQAWRSLQHGRSEIEFWHRDAAQTPHWDAYLEAAERDEMLMSAYMAISEY
NT seq 10254 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccaccgatctcgacaaaatgcagcaggccggcacgatcgttcacgtacttcag
cgacatgccggcgagcgtcccgacgcgctcgcgtatcacttcatcgaaagcccggaaacg
ggggcggggccgcagctgacctatcggcagctcgacgagcgcgcgcggcgggtcgccgcc
tacttgcggcagcatgcgaacgagaacgatcgcgtgctgctgttcttcccgccggggctc
gaatacatcgccgcgttcctcggctgcctgtatgcgggcgtgatcgcggtgccgctctat
ccgccgcggcgcggagaaaagctcgaccgcatcgcgcacgtggtgcgcgattgcggcgca
cggttcgcgttcggcgacggcgaggcggtggcgaaggcgagcgagtggttctcgggcgag
atgggccgcgcgctgtcggcggcgatcagcctgctgtcgatcgacgcggcggcggacgtc
ccgccgattccggcgagcgactatcggcgcacgccggcggacgtggcgtttctccagtac
acgtccgggtcgacgggcgagccgaagggcgtcgcggtgagtcacggcaatctgatcgcg
aatcagatcgcgatcgcggcgggcttcggatcgcgcgacgacgacgtctgcctgaactgg
ctgccgctgtaccacgacatggggctgatcggcacgaccttgcatccgctcttttacgga
tacccgtcgcacatcatgtcgccgaccgcgttcatcaaggacccgctgtcgtggctcgag
aacatcacgcggtttcgcgcgacggtcgcgggcgggccggacttcggctatcgcctctgc
gccgagcatgcggctcgcagcccggagcgggtggccgcgctcgatctgtcgagctggcgc
atcgcgttcaacggcgccgagccggtacaggcggaatcgatgcggcgtttcgcgcagatc
tacgcgcgcgcgcggttcgatccgcgcgcattctatccgtgctacggccttgccgaagca
acgcttttcgtcacgggcggcgcgcccggcggagcgtttcacgcacgggcggccgaccgt
ttcgcgctgacgctcggccgcctcgagccgcagggcggcgccgcgagcgttgaactggtg
tcgtccggccgctgcgcggccgggcacgaactgcgcatcgtcaacgacttgcgcgaggcg
gcgcaaggcgagatcggcgagatctgggtgcgcggcccgagcattccgtccggatactgg
aacaaggacgcggtgaacgccgacgtgtttcgcgcgcgcctcgccgccccggacccggcc
ccgtcgggcttcctgcgcacgggcgatctcggttgcgtcgtcgacggcgaactgttcgtg
accgggcgcagcaaggacgtcgtcatcgtcaacgggcgcaattactacccgcaggacctg
gaagccgccgcgggcgcgagcgatccggccttgcgcgaaggttgcacggccgcgttctcg
atcgacggcgagggcgatgcgcgcgtcgtcgtcgtgcaggaggtggaccggcgcttcgcg
aagacgatcgacgtcgacgccgccgcccgggcgatccgcacggcgatttcgcgcgcctgc
gacgtcgccgtcgacgagatcgtgttcattcagccggcgagcattccgaagacgtcgagc
ggcaagatccgccgccgggagacgcgcgcgcgttacctcgacggcacgctgctgctcgtc
ggccgcgacgtgcgttcggcgagcggcgccggtgcggcgtccgatcaggatctcgacgcg
ctctggccgcaagcggcgcgctccggcgcggtgcccgccgacgagcatgcggctcggatc
gtgcttgcgctgcggcgcgcggtcgcggcgctgaccgggcagacgcccgaggcgatcggc
gccgatctgccgcttgcgggcgcggggctgaattcgatcggcgtcgtgcggctgcagggc
ttgatcgagaagcatctgggcgcgcaggtcgggctcgacgacctgttcggcgcgtcgagc
atcgcggagctgggcgcgcagatcgcccgaacggacactgcggcgcccgccgcgccgcgc
gcgacggcgggtgcgaaagaacgcgagttcgcgctgtcgccgaaccagcagcagctctgg
ttcctgcatcaattcgacccggatcggcatgactacaacctggcgctcctgatcgaatgc
cggccggcgctcgcgtccgacgcgctcgaggcgagcgtcgcgcgcgcgtgcgcgcggcac
ccgatcctgcgtacgcgttatcgcgcggaggacagccgcaacgtgcagacggtcgagccg
acgccatgcgtcgatttcgccgaaatcgatccgcaagggctcgacgacgccgcgttgatc
gagcgtttcggcgacgaagcgctgcggccgttcgatctggagcggggggcggcgttgcgc
attcgcgtcgcacagcgcgacggcgggcggacctggctgctcgtcaacctgcatcacatc
gcctccgatttctggtcgatgtcgcaactcgtcgaggaaatcgtgtcggacgcgtcgggc
ggcgagccgattgccgatcccgagcgcgactaccaggactggtgccgggagcgcgacgcg
tacacgggcagcgccgctgcgctggcggaccgccagtactggcgctccgtcctgggcgag
aaccgtgcggattcggcgctcgcctcggtgttcgagccaagcgcgcaacgcgcggaaggc
gccgcggacggcgcgccgcggcccgtcaatttccggatcggcgagacgctcgcgaaacgg
gtcgaggcattcgcgcggcgctcgggccgcacgctcaacgcggtctatctggccgcgttc
cagttgctgctgcatcgccgcggcgccgccgagcacctcgcgatcggcacgctcgccgcc
ggccggacgcactgggcgtatgcgcgcacgcagggctattttgtcaatccgctcgcgttg
cacaccgcgtatcgcgacgacacgacgttcgcggcgttcctgtcgcagtcggccgacaat
ctcaccgccgcgatcgcccaccaggcgtatccgttcgcgcacctcgtcaacgagcatgcg
tcgaagaaccgcgccggccggcatccgttcttccaggcgctgttcgtgatgcagcagtcg
agcggccgccgcggcaccgaggcgttcgcgatcaagggcgtcgccgccgaaatcgaaatc
ggttcgatcaccgcgcgttcgctgccgttgcgctccgcgccgtcccagttcgatctcgcg
ttgacgatggcgcccgccgcgcgcgggatcgaagcgatgctcgaatatggcgagacgctc
gcgacgcgcgatcaggtcgccgcgttcgccgacgaatacctgcaactgctcgatgcggtg
ctcgacgcggccgacgcgccgttgcacacgatcgagcccaaggcggcgccggccgcgatc
gacgcgccggcggccgagcgcgccgccgatctcccggcggcagccgtgccgctcgcgcaa
tgcgattcgttgatcgaaggattcgagcagcaggtgcgcagcggcccgcagcgagtcgcg
ctcacctacggcgaatcgtcgctcacgtatcgcgaactggacgaacgcgcgacgcagctc
gcgcgcgcgctcgcgccgcggatgcgggccgacgggccgaccaccgccgcgcttctgctg
catcgcggcgtggacgtcgtcgtgagcatcctcgccattctgaaggcgggaggcacgtac
gtgccgctcgacccgcactctccggccgagcggctcggcttcattctcgaggacgcgcag
ccgagcgtgctcgtcacgtcgacggcgttcggcgacttgctgggcaagctgccgtccgtc
gagggccgcaccgtcctgctcgtcgacgcgctcgccgagccggcgcgcgacggggcgcac
gcagcggatcgcgcgccgcaggcggcgcgcgcgttgcgccgcgacgactgcgcgtacgtg
attttcacgtccggcacgaccgggcggccgaagggcgtgcaggtcacgcacgacaacgtg
ctgcgcctgttcacgtcgtccgagccggaataccggttcgacgagcgcgacgtgtggacg
ctgttccattcgatcgcgttcgacatctcggtctgggaaatgtggggcgcgctgctgtac
ggcggccggatcgtcggggtgccgtacgaaatctcgcgctcgccggacgagttccgcgcg
ctgtgcgcacgcgagcgcgtgacggtgctcaaccagacgccgagcgcgttcaagtatttc
atcgccgccgatctgcggcgcgacgaccgcctgagcgcgctgcgcctcgtgatcttcggc
ggcgagacgctcgtgttcggcagcctcaaggattggttccgcaagtacggcgacgcgcag
ccgctgctcgtcaacatgtacgggatcaccgagatcaccgtgcacggaacctaccggccc
gtcacgctcgcggatctcgacgcgccgggcagcatgatcggcctgccgctgcgcgacctg
tcgatcgtgctgctcgacgaggatcgcaagccggtggtggacggcgaggtcggcgagatc
tatgtcggaggccggggcgtggcgctcggctatctgcgaaacgagacgctcacgcgcgag
cgcttcgtcgatctcgacatcgagccgggcgcgggcgtggggcgctactacaagagcggc
gacctcgcgcgcaaggtcggcgacgcggattacgaatatctgggtcgcaaggatcagcag
gtcaagatcaatggttttcggatcgagctcggcgaaatcgaggcggcgctcacgcgcttc
gacggcatccgcgacgccgtcacgctcgcgagcaagccgcacaagccgcgcaacgtcgtc
gcgccggcgtcggcggacggcggggccggcgcgatcaccgagatccggcagttgatccgc
gccgcgtcgacgccgcaaccggacgacgaacagaccaggctcgtgtcgtacatcgtctgc
gatgcgctgccggacgttcaggcgctgtatcgccacctgtcggagcgcatacccgattac
atgatgccgtcggccgtgctgccgatcgatgcgattccgctgaaccagaacggcaaggtc
gacgcgaaggcgctcatgcagcgggcggacggcgcgattccgttgcgcgcggcctacgtc
gcgccgcgcaccgacgaggaaaagctgctgtgcaagctgtacgccgaagtgctggaaaaa
ccgcgcgtgggcgccaacgacggcttcttcgagctcggcggcgattcgatccgcatcatc
cagttgcgcagccgcgcgttgaaggcgggtttgcagatcagcgtccaggacgtgttccgg
ctccagacgcccgccgcgctcgccgccgtcacgaagatttcggcccagctggccgagcgg
cctcgcgtcgccgcgttcgcgcaaacgagcgacgccgagcgtcgccagttgcctgaggat
gcggtcgatgcctatccgctcgcgcgtcttcaggaagggctgctgttccactcgcaattc
ggcgacgacatcgcgatgtattgcgacatcttcgaattccggctgcgcgcgcgctacgat
ctgcgcgcgttcgagcaagcgctcgccgcgttgatcgagcgccatccgattttccggacg
tcgttccatctcggcgagttcgagcggccgctgcagatcgttcacgcgcattcggccccg
gtcgtcgacgtgttcgactatcgcgacgtcgacgacgcgcgccgcaagcagcgctacgag
gcgtggctcgacggcgaaaagcgccgtccgtacgacgtcgcgcgcgcgccgctgttgcgc
ttctcgttgcaccgctggacggacgacgagttcgtgttcacgatgtcgttccacgacgcg
ctgctcgacggctggagcgaatcgtcggccgtgtcggagatcctgcgcaactacgtgagc
ctcgtcggcgacggcgcgctgccgcagcttcccgagctgcatacgcgcttttccgattac
gtctcgctggaacaggagaccgtcgccgatccggcggtgcgcgcattctgggaagcggag
ctcgaggatttccggccgacgcggctcgcgtacctgcaggaaacgcacgcggacgccggg
cgcaatccgatgcgcttttacgcggtcgacgtgccggcggcgctgtcgaacgacctgaag
gcgctggccgcgcggctcggcgtgtcgctcaagcacgtgctgctggcggcgcatgcgagc
gtcatgagtttcgtgagcggcgagtccgacgtcgttctcgccgtcgagtcgaacggccgg
ctcgaggacggcgacggcgagcgcgtgctcggcacgcatctgaacgtcgtgccgtggcgc
gtgcagctcggcggcgacacctggtccgagctcgtcaagcgcatccatgacaaggaatcc
gcgctgcaggcgtatcgccgctatccgtatcaggaaatccagcacctgaagggcaacgag
ccgctcttcgacgtgagcttcaattacacgcacttccatgtgtacgaggagctggagcaa
ctggcgggggtgagcgtcgtcgatgcgaaggcgtatatccagacgcacttcgcgctgcgc
gtcgaattcaaccaggacccgttcacgaagcatctgacgctcgatctcgaggcgaatctc
gacgcgttgccgctcgagcgcctcgtcgcgatcggcggctatttccgccgcgcgctcgag
gcgatcgtcgcgtcgcccgacgagcatttcgccgcgcgcacgctgctcggcgacgacgag
gccgccgtcgagcgccgcgccgccgcgggcgccctggtcgaacggccggcgggcgcgcca
gggctatatgtcgcgacgttcgagcggcgcgcgagcgaatggccggatcgcatcgcggcc
gtcgacgcgtcgcgctcgatcggctatcgcgcgctgctcgacgcaagccgcacggccgcc
gcgcagctgcgcgcgcgcggcgtgcgtccgggcgacatcgtggcgctgctcgcggatcgc
tcgatcgactatctgacggcgatcctcgggctctggcgggtcggggcggcgttcgtgccg
ctgccggacgggccggccgagcggatcgacgcgctgctcgagcgcgcgcgggccgcgcat
ctcgtcgtcgcgcgcgggcatgcgagcgtcgccgagcgcctgcgcagcggcgcggccagg
atcgcgctcgacgcgctcgccgagccggccgacgcggccgcgctgcgagcgcccgcgttc
gaggcgtgcgccgacacgctcgcttacgtgatcttcacgtccggttcgacgggcgagccc
aagggcgtgatgatcgaccacggcgggatgatcaatcacatcgaggcgaagatcgaggat
ctcgggatcggcgcggcggacatcgtgtcgcaggacgccgccgcgacgttcgacatctgc
gtgtggcaattctgcgcgccgttgatcgcgggcgcgcaggtcaggatctacgacgacgcc
gtcgcgaaagatccggcgcggctcctggagcgcgtcgtcgccgacggcgtgtcgattctc
gaagtgtcgccgtccgtgctgagcacgatgctgctcgtgcacgccgcgcagccggacgcg
ccggcgctcgcgctcggcgcgtcggcgctgcgctgggtcgtgtcgagcggcgagacgctg
cagccgtcgctcgtgcatcagctgcgcgcggtgcaccctcgcgtcggcatcctgaacatg
tggggcgcgacggaaacctccgacgactgcacgcattacaaggtgccgttcgacctcgac
gcgcgcgcgccgaagatctcgatcgggcggccgatcaagaacgcggccgtctacgtgctc
gatccgtgggggcgcacggtgccggccggcacgcccggcgagctgtacgtcggcggcgtg
tgcgtcgggctcgggtatctgaacgatccgcagcgcaccgcggccgcctattcgtcgcgg
gaggccgcgttcgccggctcgcatcgcctctatcgcagcggcgatcgcggatggcgcgcc
gcgaacggcgagctgttcttcatcggccggcgcgacaaccaggtgaagatccgcggccat
cgcatcgagattggcgaagtggaggccgcgctcaatcgcgagccgtcggtgcaggaagcg
gtcgtcctcgcgctgccggacgcgacggggcaactgtcgctcgcggcgtgggccgttcct
gcggatcttcgcgcgctggagggcgcgggcgcgacgagcgcgtgggcgtcggcgctgcgc
aagcaggtgaagctcgggctgcccgcgtacatgattcccgacgtgatcgtcgcgctcgac
cgtctgccgaagaacgtcaacggcaaggtggaccgcaaggcgctcgcgttgccggacgat
gcgcagacgtgcgcgcagctcgaggtggtcgcgccgggcaacgacgtcgaggccttcgtc
gtcgatctgttccggcagattctcaagcgcccggcggtcagcgccgactggagcttcttc
gacatcggcggcaactcgctgctcgcgacgcaggtcgtgtctcgcgcgcgccggcatttc
cggatcgatttgccgatccgcgcgctgttcgagcacgacacggcaatctcgttcgccgcg
gcgatcgcggccgcccaggccgaggcgttgcgggaggacacgatcgcgccgcaggggcgc
cccgagcacattccgctgtcgttcaaccaggagcgtctctggttcctcgacaagatcgac
gcctcgcagcgcgcctatggctcgcacttcgcgctgcggatcgacgggccgctcgatgtc
gacacgctcgcctgggtgctccagcggatgacggatcgccacgagatcctgcgaacccgc
ttcgcgacgctcgacaatcagccctgtcaggtggtggcgcccgagatgacgttcccgctc
gccgtgaaggacctgtccggcgagcgcgcctcgagcgcgcgcgaagcgctcgacagcgcg
atcgaatccgagctgagccggccgttcaggctcgacgcgctgccgctgtgctcggcgacg
atctaccggctgtccgacaacgagcacgtgctgctttggcgcaatcatcacatcatcgga
gacgggtggtcggcgggcgtgatcctgcgcgagatcgagcagttgtatccggcgcggcgc
gacgggcgggcggcggagctgccgccgctgccgatccagttcgccgattacgcgatctgg
cagcggcgttttgcgcagtccgagccgttcaagcgccagctcgacttctggcgcggctac
ctcgacggctacgccggcgtgctgcaattgccgaccgatttcgagcgcccggaccagccg
acgttcgacgggcggcggatcgcggtggcgctgcccgccgggctcgtcgagcgcgtgcat
gcgttctcccgggcgtcgaagtcgacggtgttcgtgttcctgcagaccgcgctgggcttg
ctgctgtcgcgctacgcgaagcagggcgacctcgtgctcggcacggccgtcgcgaaccgc
tcgcgcatcgagaccgagccgctcatcggcttcctgacgaacacgttgccggtgcggcag
cgcttcgatccgtccgcgagcttcgccgcgcatctcgcgcgcgtgcgcgacgacgtgctg
aacgtgttcgacagtcaggacgtgacgttcgcgcatctcgtgcagatggcgctcagggag
cgcgacccgcgcgtgaatccgctcgtgcaggtgatgttcgtgctgcagaacgaggatctg
tcgatgccgcaggtcgacgggctgcgcatcgcgcccgtcgagctcgaccgggccgcgtcg
attctcgatctgctgttcgatctgcgcgaggagggcggcgcgatcgtcggccacgtcgaa
tacaacgtcaatctgttccgggaatcgacgatccgcctgctgtgggcgcatctgtcgaac
ctgatcggggcgatcgtcgacgggggcgacgtgccggtctcgcagctgagctcgctcggc
gacgaggagcggcgcctgctgacgcaagcgtggcgcagcctgcagcacggccgcagcgag
atcgagttctggcatcgcgacgccgcgcaaacgccgcattgggacgcttacctcgaagcg
gccgagcgcgacgagatgctgatgagcgcatacatggcgatctcggaatattga

DBGET integrated database retrieval system