KEGG   Burkholderia pseudomallei MSHR511: BBQ_3897Help
Entry
BBQ_3897          CDS       T03012                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bpsm  Burkholderia pseudomallei MSHR511
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bpsm00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BBQ_3897 (ligD)
Enzymes [BR:bpsm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BBQ_3897 (ligD)
DNA repair and recombination proteins [BR:bpsm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BBQ_3897 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2:427042..430533
Genome map
AA seq 1163 aa AA seqDB search
MAGKLSVYRSRRRFGETPEPEGARRSPRRTKGTGRAGDESKRRARGDAAASSRGERAARS
GRAQQPAPARARGRSALHYVIQEHHARRLHYDFRLELDGTLKSWAIPKGPSLDPSVKRLA
VHVEDHPLEYAAFEGEIPEGHYGAGSVIVWDRGAWTPAGGVAAARAGYRAGKLSFTLDGD
KLHGGWALVRGRGLRDSGGKHEQWLLIKERDGDARDEADYDVLRARPGSVLGGARSARAR
RGRAAEPTERDAAAPKRARASVPKGRAEAKTSGRAPRTVSNGTAGAGKGASKRASKREGT
NTGNGARSGKGSGKGAGEGVATSRRKRAAAPQSSDVDSADTDSPAARGLALPAGLAARFG
LSGAKRAALPRTLRPQLATLVDAPPPGKDWLYEAKFDGYRVLIRIDRGAASCPIAVYTRE
GLDWSAKFAAQLDALARLPVDRGWLDGEAVVLDRAGVPDFQALQNALGAGRSNDVTLFLF
DVPFLNGFDLRGVPLERRRALLAALVAAHASDVLRYSESLAFEAADLLTGACDAGLEGLI
GKRRDGRYVEGRSRSWIKLKCRRRQEFVIGGYTEPAGRRSGFGALLLGVYARAPGDEGDE
GERRTRGAAETRDERRRASHASRTSRTSRTSRAPDAGAARAPQARPLALRYVGRVGTGFG
ERTLRALARTLREHETGRMPFADVPRERSGTPVHWVKPVLVAECEFAEWTGDGIVRQASF
VGLREDKPARTIVREQPQSMETEAMNEHADEHTDEHTDARAERRTGGRTRRKARDGGARD
APPLARHPKRGDAGSSARKGARDGEAGKRAAAGSSPSSSPSSSTSPSISASGRTRGGGRS
ASRDRAGDADEGANEDANDHAPRERAGAPKVAGVRVSHPGRVIDPHTGTRKLDLVEYWEW
IAPWLLPHLKGRPVSLVRAPADIGGELFFQKHADKLEIPNVALHAGLDPGHEALITIDDV
KGLIGAAQMGTIELHTWNAHVSNIEKPDRAVFDLDPDPSLDWRAVIEAAQLTRALLDELG
LVSFCKTSGGKGLHVVVPLARHAGWDDVKAFAHAVARHMAATLPERFTATMGPRNRKGKI
FVDYLRNNRGASTIAAYSVRARPGLGVSVPIAWDELPDTTGAAQWTLANLHERLDTLKHD
PWRAYAHVRQRVTAALRKRLSDG
NT seq 3492 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaaaactcagcgtgtaccgcagcaggcggcgcttcggcgaaacgccggagccc
gagggcgcgcggcggtcgccgcgccgcacgaaaggcacgggccgcgcgggcgacgaatcg
aagcggcgcgcgcgcggcgatgcggcggcgtcgagccgcggcgagcgcgccgctcgcagc
ggccgcgcgcagcagccggcgccggcgcgcgcgcgcggcaggtccgcgcttcattacgtg
atccaggagcatcacgcgcgccgcttgcattacgactttcgtctcgaactcgatggcacg
ctcaaatcgtgggcgatcccgaaagggccgagcctcgatccttcggtcaagcggctcgcg
gtgcacgtcgaggatcatccgctcgaatacgcggcgttcgagggcgagattccggaaggc
cattacggcgcgggctcggtgattgtctgggatcgcggcgcatggacgcccgccggtggc
gtcgccgccgcgcgcgccggctatcgcgcgggcaagctgagcttcacgctcgacggggac
aagctgcacggcggctgggcgctcgtgcgcggccgcgggctgcgtgacagcggcggcaag
cacgagcaatggctgctgatcaaggaacgcgacggcgacgcgcgcgacgaagcggactac
gacgtgctgcgcgcacggccgggcagcgtgctcggcggcgcgcggtccgcgcgggcgagg
cgcgggcgcgcggccgagccgacggagcgcgacgccgccgcgccgaagcgggcgcgcgct
tcagtgccgaaagggcgcgccgaagcgaagacgagcgggcgtgcgccgcgcaccgtgtcg
aacgggactgcgggcgcgggtaagggcgcaagcaagcgtgcaagcaagcgcgagggcacg
aataccggaaacggcgcgagaagcggcaagggcagcggcaagggcgcgggcgagggcgtg
gccacatcgcgccgcaaacgcgccgccgcgccgcagtcgtccgacgtcgattcggccgat
accgattcacccgcggcgcgcggcctcgcgttgcccgccgggcttgccgcgcgcttcggc
ctgagcggcgcgaagcgcgcggcgctgccgcgcacgttgcggccgcaactggcgacgctc
gtcgatgcgccgccgcccggcaaagactggctatacgaagcgaagttcgatggctaccgc
gtgctgatccggatcgatcgcggcgcggcgtcctgcccgattgccgtctacacgcgcgag
gggctcgactggagcgcgaaattcgccgcgcagctcgacgcgctcgcgcgcctgccggtc
gaccggggctggctcgacggcgaggcggtcgtgctcgatcgcgcgggcgtgccggatttc
caggcgctgcagaacgcgctcggcgccggacgctcgaacgatgtcacgctgttcctgttc
gacgtgccgttcctgaacggcttcgacctgcgcggcgtgccgctcgaacggcggcgcgcg
ctgctcgccgcgctcgtcgccgcgcatgcgagcgacgtgctgcgttactcggagagcctc
gcgttcgaggccgccgatctgctgacgggcgcgtgcgacgcggggctcgaagggttgatc
ggcaagcggcgcgatggccggtacgtcgaggggcgctcgagatcgtggatcaagctgaag
tgccggcgcaggcaggagttcgtgattggcggctacacggagccggccggacggcgcagc
ggattcggcgcgttgctgctcggcgtgtacgcccgggcgccgggcgacgagggcgacgag
ggcgaacgaaggacgcgcggcgcggccgaaacgcgcgacgagcggcgtcgtgcatcccac
gcatcccgcacgtcccgcacatcccgcacatcccgcgcgcccgatgccggcgcggcgcgc
gcaccgcaggcgcggccgctcgcgttgcgctacgtcggccgcgtcggcaccggcttcggc
gagcgcacgcttcgcgcgctcgcgcggacgctgcgcgagcacgagaccgggcggatgccg
ttcgcggacgtgccgcgcgagcgcagcggcacgccggttcactgggtgaagcccgtgctc
gtcgccgaatgcgaattcgcggaatggacgggcgacggcatcgtccggcaggcgtcgttc
gtcgggctgcgcgaagacaagccggcgcgcacgatcgttcgcgagcaaccgcaatccatg
gagacggaagccatgaatgaacacgctgacgaacatacggatgaacataccgatgcacgc
gccgaacgtcgcaccggcggacgcacgcggcgcaaagcacgtgacggcggcgcgcgcgac
gcgccgccgcttgcccgtcatccgaagcgcggcgatgcgggatcgtccgcgcgcaagggc
gcgcgggacggggaggcgggcaagcgcgccgccgcggggtcgtcgccttcgtcttcaccg
tcgagttcgacttcgccttcgatttcggcgtcagggcgcacgcgcgggggcggtcgttcc
gcctcgcgcgatcgagccggcgatgcggacgaaggcgcgaacgaagacgcgaacgatcac
gcgccgcgcgagcgcgccggcgcgccgaaggtggcgggcgtgcgcgtctcgcatcccggc
cgcgtgatcgatccgcacacgggcacgcgcaagctcgacctcgtcgaatactgggaatgg
atcgcgccgtggctgctgccgcatctgaagggccggccggtgtcgctcgtgcgcgcgccc
gccgacatcggcggcgagttgttcttccagaagcacgcggacaagctggagattccgaac
gtcgcgctgcacgcggggctcgacccgggccatgaggcgctcatcacgatcgacgatgtg
aaggggctcatcggcgccgcgcaaatgggcacgatcgagctgcacacgtggaacgcgcac
gtgtcgaacatcgagaagccggaccgcgcggtgttcgacctcgacccggacccgtcgctc
gactggcgcgcggtgatcgaggccgcgcagctcacgcgcgcgctgctggacgagctcggc
ctcgtgtcgttctgcaagacgagcggcggcaaggggctgcacgtcgtcgtgccgctcgcg
cgccatgcgggctgggacgacgtgaaggcgttcgcgcacgcggtggcgcggcacatggcg
gcgaccctgcccgagcgcttcaccgcgacgatggggccgcgcaaccggaagggcaagatc
ttcgtcgactatctgcgcaacaaccgcggcgcgagcacgatcgccgcgtactcggtgcgc
gcgaggccggggcttggcgtatcggtgccgatcgcatgggacgaactgccggatacgacg
ggcgccgcgcaatggacgctcgcgaacctgcacgagcgtctcgacacgctgaagcacgac
ccgtggcgcgcctatgcgcatgtgcggcaacgcgtgacggcggcgttgcggaagcggctg
agcgatgggtag

DBGET integrated database retrieval system