KEGG   Burkholderia pseudomallei A79A: X996_1867Help
Entry
X996_1867         CDS       T03498                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bpso  Burkholderia pseudomallei A79A
Pathway
bpso00010  Glycolysis / Gluconeogenesis
bpso00020  Citrate cycle (TCA cycle)
bpso00620  Pyruvate metabolism
bpso01100  Metabolic pathways
bpso01110  Biosynthesis of secondary metabolites
bpso01120  Microbial metabolism in diverse environments
bpso01130  Biosynthesis of antibiotics
bpso01200  Carbon metabolism
Module
bpso_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bpso00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    X996_1867 (aceF)
   00020 Citrate cycle (TCA cycle)
    X996_1867 (aceF)
   00620 Pyruvate metabolism
    X996_1867 (aceF)
Enzymes [BR:bpso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     X996_1867 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_D23 NQRA DEC-1_N
Motif
Other DBs
NCBI-ProteinID: AIV96974
LinkDB All DBs
Position
1:2092441..2094084
Genome map
AA seq 547 aa AA seqDB search
MSQAIEVKVPDIGDYKDVPVIEVLVKPGDAVEPEQSLVTLESDKATMDVPSPSAGTVKEV
KVKVGDAVSQGSLIVLLDGAQAAAQPAQANGAATSAAQPAAAPAAAPAPAAAAGGGTVDV
KVPDIGDYKDVPVIEIAVKIGDTVEKEQSLVTLESDKATMDVPSPAAGVVKDIKVKVGDA
VSEGSLIVVLEASGGAAASAPQAAAPAPAPAAPAPAPAPQAAPAAAPAPAQAPAPAASGE
YRASHASPSVRKFARELGVDVSRVTGTGPKSRITKDDVTAFVKGVMTGQRAAPGAAAAPA
GGGELNLLPWPKVDFSKFGPFEAKPLSRIKKISGANLHRNWVMIPHVTNNDEADITELEA
LRVQLNKEHEKAGVKFTMLAFVIKAVVAALKKFPTFNASLDGDNLVFKQYYHIGFAADTP
NGLVVPVIRDADKKGLVDIAKEMAELSKAAREGKLKPDQMQGGCFSISSLGGIGGTHFTP
IINAPEVAILGLSRGQMKPVWDGKQFVPRLTLPLSLSYDHRVIDGAEAARFNAYLGALLA
DFRRIIL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtcaaggtgccggatatcggcgattacaaggacgtgcccgtc
atcgaagtgctcgtgaagccgggcgatgcggtcgagcccgagcagtcgctcgtcacgctc
gaatcggacaaggcgacgatggatgtgccgagcccgtcggcgggcacggtcaaggaagtg
aaggtgaaggtcggcgacgcggtgtcgcaaggctcgctgatcgtgctgctcgacggcgcg
caggcggcggcccagcccgcgcaggcgaacggcgccgcgacgagcgccgcgcagccggcg
gcggcgcccgctgccgcgcctgcgccggcggcggccgcgggcggcggcacggtcgacgtg
aaggtgccggacatcggcgactacaaggacgtgcccgtcatcgagatcgccgtgaagatc
ggcgacacggtcgagaaggagcagtcgctcgtcacgctcgaatcggacaaggcgacgatg
gacgtgccgagcccggccgcgggcgtcgtcaaggacatcaaggtgaaggtcggcgatgcg
gtgtcggaaggctcgctgatcgtcgtgctcgaagcgtcgggcggcgccgccgcgagcgcg
ccgcaggcggccgcgcccgcccccgcgccggccgcgccggctccggcgcccgcgccgcag
gccgcacccgcggctgcgccggcccccgcgcaggcaccggcacccgccgcgagcggcgag
taccgcgcgagccacgcgtcgccgtcggtgcgcaagttcgcgcgcgagctcggcgtcgac
gtgtcgcgcgtcacgggcacggggccgaagagccgcatcacgaaggacgacgtcaccgcg
ttcgtgaagggcgtgatgacggggcagcgcgcggcgcccggcgccgcggccgcgcccgcg
ggcggcggcgagctgaacctgctgccgtggccgaaggtcgacttctcgaagttcggcccg
ttcgaggcgaagccgctgtcgcgcatcaagaagatctcgggcgcgaacctgcatcgcaac
tgggtgatgatcccgcacgtcacgaacaacgacgaggcggacatcaccgagctcgaagcg
ctgcgcgtgcaactgaacaaggagcacgagaaggcgggcgtgaagttcacgatgctcgcg
ttcgtgatcaaggcggtcgtcgccgcgctgaagaagttcccgaccttcaacgcgagcctc
gacggcgacaacctcgtgttcaagcagtactaccacatcggtttcgccgccgacacgccg
aacggcctcgtcgtgccggtgatccgcgacgcggacaagaaggggctcgtcgacatcgcg
aaggaaatggccgagctgtcgaaggccgcgcgcgaaggcaagctcaagccggaccagatg
cagggcggctgcttctcgatctcgtcgctcggcgggatcggcggcacgcacttcacgccg
atcatcaatgcgccggaagtggcgatcctcgggctgtcgcgcggccagatgaagccggtg
tgggacggcaagcagtttgtgccgcgcctcacgctgccgctgtcgctgtcgtatgaccat
cgcgtgatcgatggcgcggaagccgcgcggttcaatgcgtatctcggcgcgttgcttgcc
gatttccgtcgcatcattctttga

DBGET integrated database retrieval system