KEGG   Burkholderia pseudomallei A79A: X996_3790Help
Entry
X996_3790         CDS       T03498                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bpso  Burkholderia pseudomallei A79A
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpso00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    X996_3790 (aepX)
Enzymes [BR:bpso01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     X996_3790 (aepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2:complement(403504..404415)
Genome map
AA seq 303 aa AA seqDB search
MPIRELISAPITNEQRRRSFKEKLATGRALRFIESHSPISAMISEKVYVAHGASQSEFDG
FWSSSLTDSTLRGRPDIEILDIASRLANVQHIFDVTTKPLIIDGDTGGKPEHFALNVQSL
ERSGVSAVIIEDKTGLKKNSLLGNDVIQHQESIEDFCEKIRVGKAAQITDDFQIIARVES
LILDKGMPDALARAAAYCEAGADGVMIHSRKKDADEVIEFAQRFRACRRDAYLVCVPTSF
NAISFSELARHFSVVIYANHLLRAAYPAMLAVAEGILAHGRTLEIEERCLPVNEILKLIP
GTA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgccaataagagaattaataagcgcgccgattaccaacgaacaaagacgccgatcgttc
aaggaaaagctggcaaccgggcgcgcgctgcgcttcatcgaaagccacagcccgatttcc
gcaatgatcagcgaaaaggtttatgttgcgcacggagcgtctcaatccgagttcgacggc
ttctggtcgagttcactgaccgactcgacgctgcgcggccggccggacatcgaaatcctg
gatatcgcgagcaggctcgccaatgtccagcatattttcgacgtgacgacgaagccgctc
atcatcgacggcgacacgggcggcaagcccgagcatttcgcgctgaacgtgcagtcgctc
gagcgatccggcgtctcggcggtgatcatcgaggacaaaacggggttgaagaaaaattcg
ctgctcggcaacgacgtgattcagcaccaggaatcgatcgaggatttctgcgaaaagatt
cgcgtcggcaaggccgcgcagatcaccgacgattttcagatcatcgcccgcgtcgagagc
ctgattctcgacaagggcatgccggacgcgctcgcgcgcgcggccgcgtattgcgaggcc
ggcgccgacggcgtgatgatccacagccgcaagaaggacgcggacgaagtgatcgaattc
gcgcagcggttccgcgcatgccgccgcgacgcgtatctcgtgtgcgtgccgacgagcttc
aacgcgatttcgttcagcgagctcgcgcgccacttcagcgtcgtgatctacgcgaatcac
ctgctgcgcgccgcgtatccggcgatgctcgcggtcgccgagggcattctcgcgcacggc
cgcacgctcgagatcgaagaacgctgcctgcccgtcaacgagatcctgaagctcattccg
ggaaccgcgtga

DBGET integrated database retrieval system