KEGG   Bordetella petrii: Bpet3018Help
Entry
Bpet3018          CDS       T00637                                 

Gene name
aceF
Definition
(GenBank) Dihydrolipoamide acetyltranferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bpt  Bordetella petrii
Pathway
bpt00010  Glycolysis / Gluconeogenesis
bpt00020  Citrate cycle (TCA cycle)
bpt00620  Pyruvate metabolism
bpt01100  Metabolic pathways
bpt01110  Biosynthesis of secondary metabolites
bpt01120  Microbial metabolism in diverse environments
bpt01130  Biosynthesis of antibiotics
bpt01200  Carbon metabolism
Module
bpt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bpt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bpet3018 (aceF)
   00020 Citrate cycle (TCA cycle)
    Bpet3018 (aceF)
   00620 Pyruvate metabolism
    Bpet3018 (aceF)
Enzymes [BR:bpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bpet3018 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 DUF2118 RnfC_N Peptidase_M23 CAT HlyD_3
Motif
Other DBs
NCBI-ProteinID: CAP43360
UniProt: A9ISY2
LinkDB All DBs
Position
complement(3160084..3161775)
Genome map
AA seq 563 aa AA seqDB search
MSKLVEIKVPDIGDFKEVEVIEVLVSEGDTIQAEQSLITVESDKASMEIPASSGGVVKSV
KVKVGDKVAEGKVILEVEAGEAAGADQAPASPDKADAAAKQPSSGDAPKTQGQTVEAPDV
KPAADAGKGAGGIAEITVPDIGDFKEVEVIEVMIAVGDTIKPEQSLITVESDKASMEIPA
SAGGVVKEVKVKVGDKVAKGTAIAVVEGQGGAQAEPQKAQAPAQAQEQQPSGAASASAAA
PAPAAKPAPAAALEDPGLKPGQLPHASPSVRKFARELGVNLSKVKGSGPKDRITADDVRA
FVKQALAAPAAAAGGADGAALGLLPWPKVDFTKFGPVEAKPLSRIKKISGANLHRNWVMI
PHVTNNDEADITDLEALRVTLNKENEKAGIKVTMLAFLIKAVVAALKKFPEFNASLDGDQ
LVYKQYYHIGFAADTPNGLVVPVIRDADKKGILEIAKEMGELSKKARDGKISPAEMQGGC
FSISSLGGIGGTHFTPIINAPEVAILGVSRSAHKPVWDGKQFVPRLIVPLSLSYDHRVID
GAAAARFNAYLGQLLADFRRIVL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaactcgtggaaatcaaggttccggacataggcgacttcaaggaagtggaagtc
atcgaggtgctggtgtccgagggcgatacgattcaggccgagcaaagcctgatcacggtc
gagtccgataaggcgtcgatggagattccggcgtcgtcgggcggtgtggtgaagtcggta
aaggtgaaggtgggcgacaaggttgccgaaggcaaggtgatcctggaggtcgaggccggc
gaagccgccggcgcggaccaggcgcctgcctcgccagacaaagccgatgcggccgccaag
cagccgtcttcgggcgacgcgcccaagacccagggccagacggtggaagcccccgatgtg
aaacctgccgcggacgcgggcaagggcgccggcggcattgccgaaatcacagtgcccgac
attggcgacttcaaggaagtggaagtcattgaagtcatgatcgccgtgggcgacaccatc
aagcccgagcaaagcctgatcacggtcgagtcggacaaggcctcgatggaaattccggcg
tcggcgggcggggtggtcaaggaagtgaaggtcaaggtcggcgacaaggttgccaagggc
accgccattgccgtggtggaaggccagggtggcgctcaggccgaaccgcaaaaggcccag
gcgcccgcccaggcgcaggaacagcagccgtctggcgccgccagcgcttccgccgccgcc
cctgctcctgccgccaagccggcgcccgccgccgcgctggaagatccgggcctcaagcct
ggccagttgccgcatgcttcgccatcggtgcgcaaattcgcacgcgaactgggcgtgaac
ctcagcaaggtcaagggttcgggcccgaaggaccgcattaccgccgacgatgtgcgcgcc
ttcgtgaagcaggcgctggccgccccggccgccgccgcgggcggggccgatggcgccgcg
ctggggctgctgccctggcccaaggtcgacttcaccaagttcggcccggtcgaagccaag
ccgctgtcgcgcatcaagaagatttcgggcgccaacctgcaccgcaactgggtcatgatc
ccgcacgtcaccaacaacgacgaagcggacatcaccgacctggaggccttgcgcgtcacg
ctcaacaaagagaacgagaaggccgggatcaaggtcaccatgctggccttcctgatcaag
gcggtggtggcggcgctgaagaagttcccggaattcaacgcctcgctcgatggcgaccag
ctggtctacaagcagtactaccacatcggcttcgcggccgacacgcccaacgggctggtg
gtgccggtgatccgcgacgccgacaagaagggcattctggaaatcgccaaggaaatgggc
gagctgtccaagaaagcccgcgacggcaagatctcgcccgccgaaatgcaaggcggctgc
ttctcgatctcgtcgctgggcggcatcggaggcacgcacttcacgcccatcatcaatgcg
ccggaagtggccatcctgggcgtgtcgcgctcggcgcacaagccggtgtgggatggcaag
cagttcgtgccgcgcctgatcgtgccgctgtcgctgtcgtatgaccaccgggtcatcgac
ggcgccgccgccgcgcgctttaacgcatacctgggccagctgctggccgacttccgccgc
atcgtgctgtaa

DBGET integrated database retrieval system