KEGG   Bordetella petrii: Bpet3851Help
Entry
Bpet3851          CDS       T00637                                 

Definition
(GenBank) superoxide dismutase, Cu-Zn
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bpt  Bordetella petrii
Brite
Enzymes [BR:bpt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Bpet3851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4059524..4060054
Genome map
AA seq 176 aa AA seqDB search
MQHCLKLVLLAGALGLAAAARADVTVPMHLAGDKGPGSEIGSVSLADSKYGLVLTPALKG
LPPGVHGFHVHENASCDAKQQDGKAVPAGAAGGHYDPDGAKKHGAPWSDDSHRGDLPALY
VGADGSAATPVLAPRLKLADVRGRALMVHAGGDNHSDHPKPLGGGGGRIACGVIPK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgcagcattgtctgaagctcgtcttgctggccggcgcattgggtctggccgccgccgcc
cgcgcagacgtcaccgtgccgatgcatctggccggcgacaaggggcccggctccgaaatc
ggctcggtcagcctggccgacagcaaatatggcctggtgctcacacccgctctgaagggg
ctgccgccgggcgtgcacggcttccatgtgcatgaaaacgccagctgcgacgccaagcag
caagacggcaaggccgtgccggccggcgcggcgggcggccactacgatcccgacggcgcc
aagaaacacggcgccccctggagcgacgacagccaccgcggcgacctgcctgccctgtat
gtgggcgccgacggctcggccgccacgccggtgctggcgccgcgcctgaaactggccgac
gtgcggggccgcgccctgatggtgcatgccggcggcgacaaccacagcgaccatcccaag
ccgctgggcggcggcggcgggcgcatcgcctgcggggtgatccccaagtga

DBGET integrated database retrieval system