KEGG   Paraburkholderia phenoliruptrix: BUPH_02682Help
Entry
BUPH_02682        CDS       T02300                                 

Definition
(GenBank) aldehyde dehydrogenase (NAD+)
Organism
bpx  Paraburkholderia phenoliruptrix
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFT86254
UniProt: K0DSB5
LinkDB All DBs
Position
1:complement(2538464..2539960)
Genome map
AA seq 498 aa AA seqDB search
MTTSRFDPQAELSDDVRSRFYIGGHWVLPNSKETASLVSPTTEKSFLSVPLADRRDVDDA
VRAARKAFDTGPWPLMSAAERSDYLRRLSGAVASRMQLLSRLWTAEVGAPVWFADLFTPT
ATAMLEYYAELSLSFPFKEHRQTRGGHARVLRQPVGVTALIAPWNAQLPILAYKLSAALA
AGCTVVVKAPPETPLDALVLAECAHEVDLPPGVLNVITADADRGAHLVANVAVDKVSFTG
STATGKVIAKTCADRLARVTLELGGKSAAIILEDAELEPTLASLSPYTMPFSGQICFAQT
RILVPRNREQEIVEAYSAVIGGLNVGDPWDETTQIGPLANRRQFDRVLRYIDVGRSEGAR
LATGGKSCERFERGYFVEPTIFSGVTPDMTIAREEIFGPVVTVTAYDDLDHAIALANDSD
FGLSGTVFTTDVERGYDVARQLKTGNVSVNGLEMSPNVPFGGIKQSGVGREGGPEGLSAF
LEDQAIYLPSEAQPSKLA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaccacttcgcggtttgatccacaagctgagttgagtgacgacgtgcggtcccgtttt
tatattggagggcattgggtactgccgaattcgaaggaaacagcatcgcttgtgtcacca
acgacggagaaatcgtttctttccgttcctctcgctgatcggcgggacgtggatgacgcg
gtccgagcggccagaaaggcctttgatacgggaccatggccacttatgtccgcggcggag
cgctctgattacttgcgacgcttgtcgggcgctgtggcgtcgcgcatgcaactgctgtcc
cggctgtggacggcggaggtcggcgcgcctgtctggttcgcagacctgttcactcctact
gcgactgcgatgctcgaatactacgcggagctgtccctatcctttccgtttaaggaacat
cgtcaaacgcgaggagggcacgcgcgagttctccggcaaccggttggggtaaccgccttg
atcgcgccatggaacgcacaattgccaatcctggcgtacaagttgagcgctgcccttgcc
gccgggtgcaccgtggttgtcaaggcacctcccgagacccctcttgatgcgttagtgctg
gcggaatgcgcacatgaagtagatttgccgccgggtgttctcaatgtgattacggcagac
gcagatcgtggcgctcatctggtggcgaatgtcgcggtcgacaaggtcagcttcactggc
agcactgcaaccgggaaagtgatcgccaaaacctgtgccgatcgactcgcacgagtcacg
ctggaactcggtgggaagtccgcagcaatcattctcgaagacgcagaactcgaaccgact
ctcgcctcgttgtctccgtacaccatgcctttttccgggcagatctgtttcgctcaaacc
cgtattctggttccgcgcaatcgagagcaagaaattgtcgaggcttatagtgccgtaatc
ggtggactgaacgtaggagatccatgggatgagaccacacaaatcggcccactcgcgaat
cgtcgccagttcgatcgggtccttcggtacatcgatgttggacgtagcgaaggagcgcga
ttagccacaggaggaaagagctgtgagcgcttcgaaaggggctattttgtcgagcccacc
atcttttcgggtgtaacacctgatatgacaattgcgcgcgaagagatatttggcccggtc
gtcactgtaaccgcgtacgacgatctcgatcacgctatcgcacttgcaaacgattcagat
tttgggttaagcgggaccgtgttcacgacagatgtagaacggggctacgacgtcgcgcgg
cagctcaagaccgggaacgtctcggtaaacggcttggaaatgtcgccgaacgtacccttc
gggggaatcaagcagtcgggtgttggtcgagaaggtggtccggaaggtctaagcgcattc
cttgaggatcaggcgatttaccttccatccgaagcgcaaccttcgaaactggcatag

DBGET integrated database retrieval system