KEGG   Paraburkholderia phytofirmans: Bphyt_2282Help
Entry
Bphyt_2282        CDS       T00765                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bphyt_2282
Enzymes [BR:bpy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Bphyt_2282
Transporters [BR:bpy02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bphyt_2282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_C_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ACD16681
JGI: Bphyt2282
UniProt: B2T516
LinkDB All DBs
Position
1:2571016..2571753
Genome map
AA seq 245 aa AA seqDB search
MSVELYYWDGLQGRGEFVRLALEEAGADYVEVARGEASEGLGTKTMMSVMKSKDEPYPPF
APPFLKDGDLVIAQTANILFYLGPRLNLAPSVESLRYVANGLQLTIADMVTEAHDTHHPL
ASALYYEDQKDAAKVRAHDFIDNRIPKFMSYFERVLKQNPAGDQFMVGDALTYVDLSMFQ
LIDGLLYAFPRALKRFGEHYPRLAALHDAVIERPNIAAYLQSERRIEHNEACIFRHYPEL
DKAAA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtggaactttactactgggacggcctgcaaggccgcggcgaattcgtgcggctc
gcgctggaagaagccggcgccgactacgtggaagtggcgcgcggcgaagcatcggaaggc
ctcggcaccaagacgatgatgtcggtgatgaagagcaaggacgagccgtatccgccgttc
gcgccgccgtttcttaaagacggcgacctggtgatcgcgcagaccgccaacatcctgttc
tatctcggcccgcggctgaacctcgcgccctcggtggagagcctgcgctatgtggccaac
ggcctgcaactgaccatcgcggacatggtcaccgaggcgcacgacacgcatcacccgctc
gccagcgcgctgtactacgaagaccagaaagacgccgccaaggtacgcgcgcacgacttc
atcgacaaccgcattccgaagttcatgtcgtacttcgagcgcgtgctcaaacagaatccg
gccggcgatcagttcatggtgggcgacgcgctcacttacgtcgacctgtcgatgttccag
ctgatcgacggcctcttgtacgcgtttccccgcgcactcaagcgtttcggcgaacactac
ccgcggctcgccgccctgcacgacgcggtgatcgagcgaccgaacatcgctgcgtatctg
cagtccgagcggcgcatcgaacacaacgaggcctgcatcttccggcactacccggaactc
gacaaggcggcggcttga

DBGET integrated database retrieval system