KEGG   Burkholderia pyrrocinia: ABD05_33715Help
Entry
ABD05_33715       CDS       T03962                                 

Definition
(GenBank) AMP-binding protein
Organism
bpyr  Burkholderia pyrrocinia
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3:817092..818834
Genome map
AA seq 580 aa AA seqDB search
MHRLIESLEDVAGATHRMTFVDDAGREADITYRRFAEEVFHQAGALRELGVRENDMVMLA
LPASVEHAAAMMACVMTGALPCTVPVPVRRAAAGRQVVDVACELYRPRLVVAADAQSAAW
RDDAFPAASTRVVDLATLSIAADAGTRALISAKCGRDPHHVQLTSGSTSHPKAAVLSHEN
VIANVLGIGGSVRFDIAAGDGTASWLPLYHDMGLLTLLSNLHYRAPLLMMQPNSFIRNPL
GWLKRIASARATTTSVPTFALRYCVRRFNAAAMDGVDLSACRNIFIGGERVDDATLRDFA
ATFAPYGLAASALQPCYGMAESTLAVSMHRAWHDGAVDGAPYVIADTLDRRALIERRDAQ
PVASNDGDESETETVLAMGTPIEGMAFRILDDSDHALPSRTVGEVAIRGTSVMLGYLTPD
DGTIAAPLTADGWFRTGDIGYVADGQLHILGRKKEVIIIRGSNYFPHEIEEALGAHHMLR
KSTCIAFGLPDPETGTERLVVAIEARPVDATPQTRTECQQLLAARIGFAAQDLCFVEPGS
LPRTTSGKLQRLKCRDLYANGALPVIHAPAAVEAGQGAYA
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
attcatcgcctgatcgaatcgctcgaggacgtcgcgggcgccacgcatcgcatgacgttc
gtcgacgatgcgggccgcgaagcggacatcacgtaccggcgctttgcggaagaggtgttt
caccaggccggcgcgctgcgcgagcttggcgtccgcgagaacgacatggtgatgctcgcg
ctccccgcatcggtcgagcacgcggccgcgatgatggcctgcgtgatgacgggcgcgctg
ccctgcaccgtgcccgtccccgtgcggcgcgccgccgccgggcggcaggtagtcgacgtc
gcatgcgagctgtaccggccgcgcctcgtcgtcgccgcggatgcgcagtccgccgcgtgg
cgcgacgacgcgtttcccgctgcgtccacccgtgtcgtcgatctcgcgacgctgtcgatc
gccgccgatgccggcacgcgcgcgctgatcagcgcgaagtgcggccgcgatccgcatcac
gtgcagctcacgtccggctcgacgtcgcatccgaaggcagcggtgctcagccacgagaac
gtgatcgcgaacgtgctcggcatcggcggatcggtccgcttcgacatcgcggccggcgac
ggcaccgcgtcgtggctgccgctctatcacgacatgggcctgctcacgctgctgtcgaat
ctgcactaccgtgcgccgttgctgatgatgcagccgaacagcttcatccggaatccgctc
ggctggttgaagcgcatcgcgtcggcgcgcgcgacgacgacgtcggtgccgaccttcgcg
ctgcgctactgcgtgcgtcgcttcaatgccgccgcgatggacggcgtcgacctgtccgcg
tgccgcaacatcttcatcggcggcgaacgcgtggacgacgcgacgctgcgcgatttcgcc
gccacgttcgcgccgtacggtctcgcggcgtcggcgctgcagccgtgctacggaatggcc
gagtcgacgctcgcagtgtcgatgcaccgtgcatggcatgacggtgcggtcgacggcgca
ccgtacgtgatcgcggacacgctcgaccgtcgcgcgctgatcgagcgccgcgacgcgcaa
ccggtcgcctcgaacgacggcgacgagtcggaaaccgaaaccgtgctcgcgatgggcacg
ccgatcgaagggatggcgttccgcattctcgacgacagcgaccacgcactgccgagtcgc
accgtcggcgaagtcgcgatccgcggcacgtcggtgatgctcggctacctgactcccgac
gacggcacgatcgccgcgccgctgacggccgacggctggttccgcaccggcgacatcggt
tacgtcgcggacggccagctccatatcctcgggcgcaagaaggaagtcatcatcattcgc
ggcagcaactacttcccgcacgagatcgaggaggcgcttggcgcccatcacatgctgcgc
aagagcacctgcatcgcgttcgggctgcccgatcccgagaccggcaccgagcggctggtc
gtcgcgatcgaggcgcgtcccgtcgacgcgacgccgcaaacccgcaccgagtgccagcag
ctgctcgcggcgcgcatcgggttcgccgcgcaggatctatgcttcgtcgaacccggctcg
ctgccgcgcacgacgagcggcaagctgcagcgcctgaagtgtcgcgacctctatgcaaac
ggcgcgctgcccgtgatccatgcgccggccgccgttgaagccggtcaaggagcgtacgca
tga

DBGET integrated database retrieval system