KEGG   Burkholderia pseudomallei 1026b: BP1026B_II1353Help
Entry
BP1026B_II1353    CDS       T02049                                 

Definition
(GenBank) AMP-binding domain-containing protein
Organism
bpz  Burkholderia pseudomallei 1026b
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:complement(1710704..1712464)
Genome map
AA seq 586 aa AA seqDB search
MKYGNRSQFVFLHGKPGDSAGEARLGYAQLDARARSIAAWLSACGAARRPVLLVYPEGLA
FVAAFLGCLYAGAIAVPVPVPADARSVERTRRIVRDAGIALALTPTAADAHALANCLAAP
GDAVSTVGALRCEATDALEALDASAWSRPALDASAIAFLQYTSGSTGEPKGVVVSHRNLL
HNEAQIQRVVASDADSVVTGWLPHFHDMGLIGMLLHPLYVGCDCVFMAPSTFLRRPVRWL
EAATHYAATITVAPNFAYDLCARAVKREQLGGLDLSALKVALNGAEPVRAKTIEAFSARF
APVGFDARAFSPCYGMAEVTLLASAGRPAAAPVLLDIDARALERHEASLAKPGAEALRVV
GSGRAVDLDLRIVDPQTHAVAADGRIGEIWLRGDSVAQGYWRRPDASEAAFRARTAAGDG
PYLRTGDLGFVRDGELFVTGRLKDLLIVNGRNLYPQDIEDFVRELHPALGAGAGAAFSID
ADGERVVVVHEIKEARLDDGLSAAALSARIRTALARAFDIAAPSVVLVPRGGVKRTTSGK
VQRGLTRDAFLAARLRVLHEDIQVPVRSLRVAAGEGVAQDASRGAA
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtacgggaatcgcagtcaatttgtttttctacacggaaaacccggtgattcggcc
ggcgaggcgcggctcggctatgcgcaactggatgcccgcgcgcgatcgatcgccgcgtgg
ctgtcggcgtgcggcgccgcgcgccggccggttctgctcgtctatcccgaaggcctcgcg
tttgtggcggcttttctcggctgcctgtatgccggcgcgatcgccgtgccggtgcccgtg
cccgcggacgcgcgcagcgtcgagcgaaccaggcggatcgtccgtgatgcgggcatcgcg
cttgcgctgacgccgacggccgccgatgcgcacgcgctcgcgaactgcctggccgcgccc
ggcgatgcggtctccacggtcggcgcgctgcgatgcgaggccaccgacgcgctcgaggcc
ctcgatgcgagcgcgtggagcaggccggcgctcgatgcctcggcgatcgcgttcttgcaa
tacacgtccggctcgacgggagagcccaaaggcgtcgtcgtgtcgcatcgtaatctgctg
cacaacgaagcgcagattcagcgtgtcgtggcgagcgacgccgatagcgtcgtgacggga
tggctgccgcattttcacgacatggggctgatcggcatgctgctgcatccgctgtacgtc
ggctgcgactgcgtgttcatggcgccgtccacgttcttgcggcgtcccgttcgatggctg
gaggccgcgacgcattacgcggccacgattacggtcgcgccgaacttcgcgtacgacctg
tgcgcgcgcgccgtgaagcgcgagcaactcggcgggctcgatctgtccgcgctgaaggtc
gcgttgaacggcgcggagccggttcgcgcgaaaacgatcgaagcgttctcggcgcgtttc
gcgccggtcggcttcgatgcacgggcgttttcgccgtgctacgggatggccgaggtcacg
ttgctcgcgagcgcgggccgcccggcggcggcgcccgtgctgctcgatatcgacgcgcgg
gcgctcgagcgccatgaggcatcgttggcgaagcccggtgccgaggcgttgcgcgtcgtg
ggcagtgggcgcgccgtcgatctcgatctgcgcatcgtcgatccgcaaacgcacgccgtg
gcggccgacgggcgcatcggcgagatctggctgcgcggcgacagcgtcgcgcaaggctac
tggcgccgccccgacgcgagcgaggcggcgttccgggcgcgcacggccgcaggcgacggg
ccgtatctgcggaccggcgatctcggtttcgtgcgggacggggagctgttcgtgaccggg
cgcctcaaggacctgctgatcgtcaacggccgcaacctctatccgcaggacatcgaggat
ttcgttcgcgagttgcatcccgcgctcggcgcgggcgcgggcgcggcgttttcgatcgat
gcggacggcgaacgcgtcgtcgtcgtccatgaaatcaaggaggcgcggctcgacgatggc
ctttcggccgccgcgctgtccgctcgcatcaggacggcgctcgcgcgcgcgttcgacatc
gcggccccgagcgtcgtgctcgtgccgcgcggcggcgtgaagcgcacgacgagcggcaag
gtgcagcgcggcctcacgcgcgacgcgtttctggccgcgcggctgcgcgtgctgcacgag
gatatccaggtgccggttcggtcgttgcgtgtggccgcgggcgagggcgtcgcgcaggat
gcctcccggggcgccgcatga

DBGET integrated database retrieval system