KEGG   Bradyrhizobium sp. ORS 278: BRADO1528Help
Entry
BRADO1528         CDS       T00516                                 

Definition
(GenBank) Putative Kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    BRADO1528
Enzymes [BR:bra01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     BRADO1528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
1632063..1633256
Genome map
AA seq 397 aa AA seqDB search
MADFSHTRSLFRIPEGVIYLDGNSLGALPLAVPGRVARMIEAEWGQELIRGWNSAGWMVQ
PRRVGDRIARLIGAAPGTVVMGDTLSIKVYQALAAALSLNPKRGVILSDSGNFPSDLYMA
QGLIRMLGDRATLKVVEPEEVEGAIDDSVAVLMLTEVDYRTGRMHDMKALTTKAHGAGAL
TVWDLAHSAGAVPVDLAGAEADFAVGCTYKYLNGGPGAPAFIYVAPGHADIAPPALSGWM
GHEAPFAFDLDYRPGGGIERMRIGTPPIIALAALDAALDAWEGVSMQDVRAASIALSELF
IAEVEKRCPSLTLASPRDAARRGSQVSFRHTDGYAIMRALIARGVIGDFRAPDALRFGFT
PLYIGEAEVRGAVDILEDVLAKKLWDRPEYRQKELVT
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttttctcacacaagatcgcttttcaggattcctgagggagtcatctatctc
gacggcaattcgctcggcgcgctgcccctggcggtgccggggcgcgtggcccggatgatc
gaggccgaatggggccaggagctgatccgcggctggaacagcgccggctggatggtgcag
ccccgccgcgtcggcgaccgcatcgcccggctgatcggcgccgcgcccggcacggtcgtg
atgggcgatacgctctcgatcaaggtgtatcaggcgctcgccgccgcgctgtcgctcaat
ccgaagcgcggcgtgatcctgtccgacagcggcaacttcccgtccgatctctacatggcg
cagggcctgatccgcatgctcggcgatcgggccacattgaaagttgtcgagcccgaggag
gtcgaaggcgcgatcgacgacagcgtcgccgtgctgatgctgaccgaggtggactaccgc
acgggccgcatgcacgacatgaaggccctcaccacgaaggcgcacggcgccggcgcgctc
acggtgtgggatctcgcgcattccgccggcgcggtgccggtcgatctcgccggcgcggag
gccgacttcgcggtcggctgcacctacaaatatctcaatggcggtcccggcgcgccggcc
ttcatctatgtcgcgccaggtcatgccgacatcgcgccgccggcgctgtccggctggatg
ggtcacgaggcgccgttcgccttcgatctcgactatcgccccggcggcggcatcgagcgg
atgcgcatcggcacgccgccgatcatcgcgctcgcagccctcgatgcggcactcgatgcc
tgggagggcgtgtcgatgcaggatgtgcgtgcggcctcgatcgcactgtcggagctgttc
atcgccgaggtcgagaagcgctgtccgtcgctgacgctcgcttcgccgcgggatgcggcg
cgtcgcggcagccaggtgtccttccgccataccgacggctacgcgatcatgcgtgcgctg
atcgcgcgcggcgtgatcggcgatttccgcgcgccggacgcgctgcgcttcggcttcacg
ccgctctacatcggcgaggccgaggtgcgcggtgccgtcgatatcctcgaggatgtcctg
gccaagaagctgtgggacaggcccgaatatcgccagaaggagctcgtgacgtga

DBGET integrated database retrieval system