KEGG   Bradyrhizobium sp. ORS 278: BRADO2006Help
Entry
BRADO2006         CDS       T00516                                 

Gene name
gst
Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bra  Bradyrhizobium sp. ORS 278
Pathway
bra00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bra00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BRADO2006 (gst)
Enzymes [BR:bra01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BRADO2006 (gst)
Transporters [BR:bra02000]
 Other Transporters
  Pores ion channels [TC:1]
   BRADO2006 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: CAL75863
RhizoBase: BRADO2006
UniProt: A4YPN7
LinkDB All DBs
Position
2131356..2131976
Genome map
AA seq 206 aa AA seqDB search
MLKLYVAPGTCALASHIALAETGADYTIEKLSFKTNQQNSPDYLAINPKGRVPALVTEKG
ILTETPAMLAYVAQRFPRARLAPLEDAFAFAEVQSFTSYLCSTVHIAHAHKMRGYRWANE
ESSFADMKRKIPETMGACFALIEQKMLRGPFVMGGQYTICDPYLFTIAQWLEGDGVDIKA
FPKVADHVARMAERPAVQKAFAELAA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagctctatgtcgcgccaggcacctgtgcgctcgcgtcccacatcgcgctggct
gagacgggtgccgactacacgatcgagaagctcagcttcaagaccaaccagcagaacagc
ccggattatctcgcgatcaaccccaaggggcgggtgccggcgctggtgacggagaagggt
atcctgaccgagactcccgcgatgctcgcctatgtcgcgcagcgttttccgcgggcccgg
ctcgcgccgctcgaagatgcgtttgcctttgccgaggtgcagtcgttcaccagctatctc
tgctccaccgtccacatcgctcacgcgcataagatgcgcggttatcgctgggccaatgag
gaatcatcctttgccgacatgaagcgcaagattccggagacgatgggcgcctgcttcgcc
ctgatcgagcagaagatgctgcgcggtcctttcgtgatgggtgggcagtatacgatctgt
gacccctatctgttcacgatcgcgcaatggctcgagggcgacggcgtcgacatcaaggcc
ttcccgaaggtcgccgatcacgtcgcgcgcatggccgagcggcccgcggtccagaaggcc
ttcgcggagctcgcggcctga

DBGET integrated database retrieval system