KEGG   Bradyrhizobium sp. BF49: BF49_2927Help
Entry
BF49_2927         CDS       T04337                                 

Definition
(GenBank) Glutathione Stransferase unnamed subgroup EC 25118
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
brad  Bradyrhizobium sp. BF49
Pathway
brad00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:brad00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BF49_2927
Enzymes [BR:brad01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BF49_2927
Transporters [BR:brad02000]
 Other Transporters
  Pores ion channels [TC:1]
   BF49_2927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 Glutaredoxin GST_C_6 GST_N_4
Motif
Other DBs
NCBI-ProteinID: CUT11847
UniProt: A0A160U877
LinkDB All DBs
Position
I:complement(3073789..3074379)
Genome map
AA seq 196 aa AA seqDB search
MRIYGDTNSGNCLKVKWVCDKLAMPYQWIEIDTRKGETRTAQFLEMNGAGQVPTVAFDDG
RTLAQSNAIIRYLARDSALIPRDAFTAAKMDEWLFWEQYSHEPYIAVCRFQLVYLGKDAS
ELDPEKVKRGYAALDRMEQHLAANRFFAGDDVSLADVSLLAYTRVAHQGGFDLGRYAAIR
RWIGEAETFLGLPKVR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcggatctacggcgataccaattccggcaattgtctgaaggtgaagtgggtctgcgac
aagctcgcgatgccctaccagtggatcgagatcgacacccgcaagggcgagacccgcacg
gcgcaattcctcgagatgaacggtgccggccaggtgcccaccgtcgccttcgacgacggt
cgcacgctggcgcaatccaatgccatcatccgctatctcgcgcgcgacagcgcgctcatt
ccgcgcgatgccttcactgccgccaagatggacgaatggctgttctgggaacaatacagc
cacgagccctatatcgcggtgtgccgcttccagctcgtctatctcggcaaggacgcctcc
gagctcgaccccgaaaaggtcaagcgcggctatgcggcgctcgatcgcatggagcagcat
ctggcggcaaaccgcttcttcgccggtgatgacgtttcgcttgccgacgtctcgctgctt
gcctatacgcgcgtcgcgcatcaaggcggcttcgatctcggtcgttatgccgccatccgc
cgctggatcggcgaagccgagacctttctcgggcttcccaaggtgcgttag

DBGET integrated database retrieval system