KEGG   Bradyrhizobium sp. BF49: BF49_5078Help
Entry
BF49_5078         CDS       T04337                                 

Definition
(GenBank) LongchainfattyacidCoA ligase EC 6213
Organism
brad  Bradyrhizobium sp. BF49
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:complement(5236310..5238010)
Genome map
AA seq 566 aa AA seqDB search
METFRSLVAVLARRAADQADDRAYVFVSDRGTEEAALTFRQLHDAAGALASRLTATARPG
DRAILVFPPGIEFMVAFFGCLMAGIIAVPMMMPRRNSARDASAAILANCTPAVALTNSAV
LLRGDLRARFEQADIRWIEVDLAAADGETIELPQPAPDDVAFLQYTSGSTSEPKGVMVSH
ANLLANLEMIRLALGNTRQSTYVNWVPLYHDMGLILNALQALYVGATCVLMAPNAFMQRP
LGWLRAISHYRAEVACSPNFGFDLCVSRYRADQMEGIDLSSLGIALNGAEPVHAETIERF
VRTFAPHGFDPRAMYPAYGMAEATLLISGGSRGGGHVTRSVSRTALQAHTAEAPADAEDT
QVAVGCGRALTGERIAIVDAESHTRLPADRVGEIWVSGANIARAYWRNDEVTREGLNARI
SGENGAWLRTGDLGFVDATGELYVTGRIKDLIIIRGINHYPQDVERTVQSLDQALRENCG
AAFSVQDESGEEALVIVQEVERTARHSIDTEAIRDLIREAIADNHELSARHIALIRPGTL
PKTTSGKIQRKLARKLWLDGGFEQFG
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccttccgctcgctcgtggcagtgctggcccggcgtgcggcggaccaggccgac
gaccgcgcctatgtcttcgtctccgatcgcgggacggaggaagctgccctcacctttcga
cagttgcacgatgccgcgggcgcgctcgcgtcacgactgaccgcgaccgcgcgtcccggc
gaccgcgccatcctggtgtttccgcccggcatcgagttcatggtggcgttcttcggctgt
ctgatggccggcatcatcgccgtgccgatgatgatgccgcggcgaaacagcgcgcgcgat
gccagcgccgcgatactcgccaattgcacgccggcggtggcgctgaccaattcggccgtc
ttgctccgtggtgatctgcgggcacgcttcgagcaagcggacattcgctggatcgaggtc
gatctcgccgcggccgacggtgagacaatcgaactgccgcagccggcgccggacgatgtc
gccttcctgcaatacacctccggctctacctccgagcccaaaggcgtgatggtgagccac
gccaatctgctcgctaatctcgagatgatccggctcgcgctcggcaacacccggcaatcg
acttacgtcaattgggtgccgctctatcacgacatggggctgatcctgaacgcactgcag
gcgctctatgtcggcgcgacctgcgtgctgatggcaccgaatgcgttcatgcagcggccg
ctcggctggctgcgcgcgatctcgcattatcgcgccgaagtggcgtgcagcccgaatttc
ggcttcgacctctgcgtcagccgctatcgcgccgaccagatggagggcatcgacctgtcc
tcgctggggatcgcgctgaacggcgcagagccggtgcatgcggagaccatcgagcggttc
gtccggacattcgcgccgcacggcttcgatccgcgcgcgatgtaccccgcctacggcatg
gcggaagcgacgctcctgatttccggcggaagccgcggcggcggtcatgtcacccgcagc
gtgagccgcacggcgcttcaggcgcatacggcggaggcgcctgccgacgccgaagatacg
caggtcgccgtcggctgcggccgcgcactcaccggcgagcggatcgccatcgtggacgca
gagagccacacacgcctgcccgcggaccgcgtcggcgagatatgggtgagtggggccaat
attgcccgtgcctattggcgcaacgacgaggtgacgcgcgaggggctcaatgcgcggatt
tccggcgaaaatggagcgtggctgcgcaccggcgacctcggcttcgtcgacgccaccggc
gaattgtacgtcacgggacggatcaaggacctcatcatcatccgcggcatcaaccattat
ccgcaggacgtggagcgcacggtgcaatccctcgaccaagctttgcgcgaaaactgcggc
gcggcgttctcggtgcaggatgagagcggtgaggaggcactcgtcatcgttcaggaagtc
gagcgcaccgcgcgccactcgatcgacactgaagcgatcagggacctaattcgcgaggcc
atcgccgacaaccacgaactctccgcgcgccacatcgcgctgatccggcccggcacgctg
ccgaagaccaccagcggcaagatccagcgcaagctggcacgcaagctctggctcgatggc
ggttttgagcagttcggctga

DBGET integrated database retrieval system