KEGG   Bradyrhizobium sp. CCGE-LA001: BCCGELA001_12590Help
Entry
BCCGELA001_12590  CDS       T04273                                 

Definition
(GenBank) ABC transporter permease
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
brc  Bradyrhizobium sp. CCGE-LA001
Pathway
brc00910  Nitrogen metabolism
brc02010  ABC transporters
Module
brc_M00438  Nitrate/nitrite transport system
brc_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:brc00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BCCGELA001_12590
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BCCGELA001_12590
Transporters [BR:brc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    BCCGELA001_12590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AMA56999
UniProt: A0A0X8CH23
LinkDB All DBs
Position
2690927..2691823
Genome map
AA seq 298 aa AA seqDB search
MNMTAAKIEIETTTPAASAAPVVALTPKRPPRSETYARMARETAVRVIPPLVVIALLTLV
WELVCRRAGSALPPPSKVFSDTKELILDPFFDHGGIDKGLFWHLSASLQRVAFGYSLSAI
AGIALGVLVGQSVWAMRGLDPLFQVLRTIPPLAWLPLSLAAFRDGQPSAIFVIFITSIWP
IIINTAVGIRNIPQDYRNVAAVVQLNPLEFFSKIMIPAAAPYIFTGLRIGIGLSWLAIVA
AEMLIGGVGIGFFIWDAWNSSHISEIILALFYVGIVGFVLDRLIAGLGKFVTRGTAQN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgactgccgccaagatcgagattgagactacgacgcccgcggccagcgccgcg
ccggttgtcgcgctaacgccgaagcgtccgccgcgcagtgaaacctacgcacgcatggcg
cgggagacggccgtgcgcgttatcccgccgctggtcgtgatcgcgctgctgacgctggtg
tgggagctggtctgccgccgcgccggctcggcgttgccgccgccgtcgaaagttttcagc
gacaccaaggaactgatcctcgatccgttcttcgaccatggcggcatcgacaagggccta
ttctggcatctatccgccagtctccagcgcgtcgctttcggctattcgctctcggcgatc
gccggcatcgcgctcggcgtgctggtcgggcagtcggtctgggcaatgcgcgggctcgat
ccgctgttccaagtgctgcgcacgattccgccgctggcctggctgccgctgtcgcttgcg
gccttccgcgatggccagccctcggcgatcttcgtcatcttcatcacctcgatctggccg
atcatcatcaacaccgccgtcggcatccgcaacatcccgcaggattaccgcaacgtcgcc
gcggtggtgcagctcaatccgctggagttcttctccaagatcatgatcccggccgccgcg
ccctacatcttcaccggcctgcgcatcggcatcggcctgtcctggctcgcgatcgtcgca
gccgagatgctgatcggcggcgtcggcatcggtttcttcatctgggacgcctggaactcc
tcgcatatcagcgagatcatcctggcgctgttctatgtcggcatcgtcggcttcgtgctg
gaccgcctgatcgcgggcctcggcaagttcgtcacccgcggcactgcgcagaattga

DBGET integrated database retrieval system