KEGG   Brevundimonas sp. GW460-12-10-14-LB2: A4249_14870Help
Entry
A4249_14870       CDS       T04395                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
brg  Brevundimonas sp. GW460-12-10-14-LB2
Brite
Enzymes [BR:brg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     A4249_14870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3008933..3009649
Genome map
AA seq 238 aa AA seqDB search
MTDLSAFPITQRWPAQHPDRIQLYSLPTPNGVKVSIMLEEVGLAYEPHLIDITKNETWGP
EFLSLNPNGKIPAILDPNGPNGKPLALFESGAILIYLAEKTGKLLSADPATRYETIQWVM
FQMGAIGPMFGQLGFFHRFAGKDYEDKRPRDRYVAESRRLLGVLETRLANDGGEPRDWLV
GDYSIADVATLGWVRNLIGFYEAGEIVGFADFPRVAAWLERGLARPAVQRGLEIPARH
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctgtccgccttcccgatcacgcaacgctggccggcccagcatcccgatcgc
atccagctgtattccctgccgacgcccaatggggtgaaggtttcgatcatgctggaagag
gtcggcctggcctatgagccgcacctgatcgacatcaccaagaacgagacctgggggccg
gagtttctgtcgctgaaccccaacggcaagatccccgccatcctcgatccgaacggcccg
aacggaaagccgctggccctgttcgaatccggcgccatcctgatctatctggcggaaaag
accggcaaactgctctcggccgatccggcgacccgctatgagacgatccagtgggtcatg
ttccagatgggcgcgatcggcccgatgttcggccagctgggcttcttccaccgcttcgcc
ggcaaggactacgaggacaagcgcccacgcgaccgctacgtcgctgaaagccgccgcctg
ctgggcgtgctggagacgcggcttgccaatgacgggggagaaccccgcgactggcttgtc
ggcgactattccatcgccgatgtcgccaccctgggttgggtccgaaacctgatcggcttc
tacgaagcgggcgagatcgtcggcttcgccgacttcccgcgcgtcgccgcctggctggag
cgcggcctggcgcggcccgccgtgcagcgcggtctagagattccggcgcgtcactga

DBGET integrated database retrieval system