KEGG   Bradyrhizobium sp. SK17: CWS35_12570Help
Entry
CWS35_12570       CDS       T05325                                 

Definition
(GenBank) glutathione S-transferase family protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
brk  Bradyrhizobium sp. SK17
Pathway
brk00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:brk00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CWS35_12570
Enzymes [BR:brk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CWS35_12570
Transporters [BR:brk02000]
 Other Transporters
  Pores ion channels [TC:1]
   CWS35_12570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2 GST_C_3 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AUC94981
UniProt: A0A2K8YBI7
LinkDB All DBs
Position
2693906..2694496
Genome map
AA seq 196 aa AA seqDB search
MKIYGDANSGNCLKVKWVCDRLALPYTWVEIDTMKGGSRTPEFLTRNGWGQVPTAELDDG
RTLAQSNAIIRYLARGSDLIPSEAYRAAQMDAWMFWEQNSHEPYVAVCRFQAVYLGKAVS
EIDPNLLQRGHIALAHLEWHLAGARFLVGDAFSLADVSLLAYTRVAEDGGLELKNYPMVR
RWIADAEQVLGLPPAR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatctacggcgacgccaattcaggcaattgcctgaaggtgaagtgggtgtgcgac
aggctggcgctgccatacacatgggtcgagatcgacaccatgaagggcggcagccggacg
ccggaattcctcacccgcaacggctgggggcaggtgccgacggcggagctggatgacggc
cgcacgctcgcgcaatccaacgccatcatccgctacctcgcgcgcggcagcgatctgatc
ccgagcgaggcttatcgcgcggcgcagatggatgcctggatgttctgggagcagaacagc
cacgagccctatgtcgccgtctgccgctttcaggccgtgtatctcggcaaggccgtctcg
gagatcgatccgaatctgttgcagcgcggccatatcgcgctcgctcatctcgagtggcat
ctggcgggcgcgcgattcctggtcggcgatgcgttctcgctcgccgacgtctcgctgctc
gcctatacgcgggtcgcggaggatggtggtctcgaactcaagaattatcctatggtccgg
cgctggatcgccgatgccgagcaggtgctcggactgccgccggcccgctga

DBGET integrated database retrieval system