KEGG   Bradyrhizobium sp. ORS 285: BRAD285_0867Help
Entry
BRAD285_0867      CDS       T04956                                 

Definition
(GenBank) Putative non-ribosomal peptide synthetase
Organism
bro  Bradyrhizobium sp. ORS 285
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
865878..878270
Genome map
AA seq 4130 aa AA seqDB search
MIEKLLSSLRQDGVQIWSENGRLRYRAPKGVMTRERLDELRARQLEIATFLQEASAAGDT
LPPIEVTRSGDLPLSFAQERLWFLEQLGLASSSYHVAVAIRMDGDLNEEALRKTFEAIVD
RHEVLRTRFDNVAGQPRQIVESNSSCRLELIDLSALDEDEQAAEVDRESILHATQPFDLQ
AGSPLRMRLLRLSAREHVLLLAMHHIVSDAWSIEVLIGEITAIYRAFCSGERAPLDPLPV
QYADYALWQRGWLAGEVLERQLQYWRQRLSGAPPQLELPISRSRSAATASTGETYAFSLS
EKATSQLRALARSESATLFMVLLAAFQLLLSRYSGQSDVVVGSPVAGRRRHELHDLIGFF
ANILVLRADCSGNQRFVDLLAQVKDTVLDAHAHQDLPFERLVEALQPDRDLVRHPLVQVM
FALQQEPFEELVLPGLRLTPMPARSLETKFDLTLHVYEKTAGLTASIEYAAELFDPDTIA
RFATHFQHLLEAIAADPHARLADLPLMRDAERLEIIFGMNRTARPFPRDASLDQLFAAQA
ARRLQAVAIVDDARSVSYAELDRWSNGIAAALAAQGVKPGASVGLSGERSAGLIAGMLGI
IKAGACYVPLDPGYPEERLAFMAGDADLAAVVMGRGGAALPGLPLLRAEEVEPVETFQCR
SAGGETVAYIMFTSGSTGVPKGIAVPHRGISRLVLGTDYIELSEDDRITHLASPSFDAAT
FELWAALLNGAALVIIDRETALDSDRLAASVRSHGISCFFATTALFNRLAQDVPEMFAPL
RVALFGGEACDPQAVASVLANGAPQRLLHVYGPTEATTFSTWMEVGHVAPDARTVPIGGP
LANGSCHVLDDRLQPVPINVPGELYVGGDGLAHGYCRRPALTADKFIFDPFGRPGSRLYA
TGDIVRRLADGNIEYLSRRDGQVKIRGFRIELQEIEAVLRQSPEVGQAVVLVREGVSGAQ
LIAYVVAAPDAEPSPDALRQQLKQSLPDYMVPAQLVILDSLPLTSNGKVDRARLPDPEET
PSRRQAAPATVIQQMLAVIWSDVLGVTMPGIDDDFFGSGGHSLVASRLLGRVNAAFNVNL
PLRRVFEAPSIRMLAAAVEQAQRDEADIAAPPVIAAPRASSIPLSYAQEPMWFLDQVGLV
GAAYNMAGALRLQGRLDVEALIASLHEIVRRHEVLRTRFCVVDGHGVQIIGPGDQLQCEV
IDLSARDTGDWDGIHRLISDHANATFDLQAGPLMRTTIVRVGNEEHLLLINLHHIVADGW
SVGVLFRELGHLYGGQCGAAQSALAPLPVQYADYAIWQRQWLDGDVGEYQLDHWRRRLAG
ATTTLALPTDRPRPAVQSFAGATLRFAMPAKLSDQLRDLARRESASLYMVFLAAFSTLLS
RYSDQRDILIGSPVNGRSRPELEDLIGMFVNMLVMRCDLVGDPAFRDYLADIKATALDAY
AHQDLPFEKLVDALQPERDLSRQPLFQACMSFENIPFDGLEIAGLTVSTVAADQHPTTKF
DLTLFVRETAGGIECALEYATDLFDATTIARFADQFVRLLQEIAARPDARLSEFSFLSSE
ERQQLESWSGSSAAYAQDRCLHELFAEHAARDPAALAVVMEGEELSYGALERRANQLAHH
LQRLGVGPDVIVGLCVERSLDMVIGVLGILKAGGAYLPLDPRYPPERLAYMLGDAEVTVL
VTQAAVRERVPATEAVVVQLDADAAAIARHPETAPLTSCDPDHLAYVIYTSGSTGRPKGV
MTSHRGIMNLADAQLDQLPLTAGDRILQFASISFDAAVWDLVMSWRVGAALVLADQHDLM
PGEPLRELLERQRVTTVLLPPAALAALPVTPLPDLKILIAGGEACTAELLRPWLAGRAVF
NAYGPTESSVCTTMHRCGDERRPPIGRALPNTRTYVLDAQLQPVPVGVAGELYIGGVGLA
RGYLHRPSLTAERFVPSPFAGGERLYRTGDLARWRADGVLDYLGRLDHQVKLRGFRIELG
EIEAALLAQAGVAQAAVVLREDGGAKRLVAYVVAQPNAAVNSDNLRQQLQRSLPDYMVPS
AIVPLGALPLTPNGKLDRNALPAPEWQGAAETMVAPRNATEATLAAIWRDVLKREQVSVT
DNFFALGGDSIQSIQVVARAWQAGLALTARQVFEQQTIAALAAVAGEATTAVAEQGLVSG
VVPPTPIQHWFFAQDLAVPDHFNQAVLLDVSALTPDLVMSALDALLHQHDALRLRFSRGD
NGWQQAHDAGAAALESATLFEAIDLSGLDEPVQAPALRRHAERLQASLDLAQGPVLRAAL
FDLGEGRQRLLLIAHHLVVDGVSWRILLEDLGTALSALQRGEPIRLPAKTTSFRHWAERL
VAHARSDAATSELSYWQNQPWHTAPRLPRDHADGANIAADVQLVKVALDAAETQVLLQEV
PEVYHTQINDVLLTALVQAFADLTGAPRLLVGLEGHGREELFDDVDVSRTVGWFTSLFPV
LLDVDGTSDPGTALKRVKEQLRAVPQRGVGYGVLRYLGHAEMRAPDVEVSFNYLGQLDGA
AGGQSFGFATEDVGRDQHASNRRAHLIDVSAHVGKDGLELRWFYGGALFEAATIERIAQR
HVAALRELIAHCRTSAGGLTPSDVPLAQLDQETLDRVVASVGGARAVADLYPLSPLQRGL
LFHSLYEPDAAVYVISLACRLQGTLDAAAFEQAWRLVVARHAVLRTAFVGHELDRPQQMV
LRQVELPFVPEDWRHLSPTEQAARFAELQRTERSRSFDFAQPPLMRLWLVRIGDDDHRLL
WNVHHIVLDGWSLPLLLDEVFAAYQALSRRETPVLSEARPFKDYIGWLQRQDMVRAEAYW
RRRLGGFDTPSSFGLARPASRPSADAGDTAERHAELHGELALADLDRFARQHRLTVNTLV
QGAWALLLGRYGRSDDVVFGVTVSGRPAELAGVERTVGLFINTLPLRVELPGQATVLDWL
AEIQDRQSELTDHQYTSLADVQRWSEISEGTALFESIVAFENYPVEMTAVSGQQQLRISE
VQPLERTNYPLTLQVTVGTTLSFRLIADTTRFAANAAGQIVAHLVRLLGEIVADPARPIS
AIPLLSDDERQEVVRGFNATAASYPQALLHEQIAAQARQMPDAVALRFEDQTLSYAALER
RANQLAHHLHNLGVGPDVVVGLCAERSLEMVIGLLGILKAGGAYLPLDPGLPPERLAYML
EDAGAKVLLVQDALVERLPANDAVVVRFAADAAAIAKQAETAPATSCDPDNLAYVIYTSG
STGRPKGVMNSHRGIVNRIAWMQDAYRLTPDDVVLQKTPFGFDVSVWEFFWPLTEGAELV
IARPGGHQDPAYLSELIERQGVTVMHFVPSMLQAFLEAADLDRCGSLRDVICSGEALPVE
TQNRFLSALPCRLHNLYGPTEAAVDVSFWPCRIEPDASQVPIGQPISNIQLYVLDAQLEP
VPVGVAGELYIGGVGLARGYLHRPSLTAERFVPSPFASGERLYRTGDLARWRADGVLDYL
GRLDHQVKLRGFRIELGEIEAALLAQAGVAQAAVVLREDGGAKRLVGYVVAQPETTINID
TLRQQLQRSLPDYMVPSAIVLLASLPLTPNGKLDRNALPAPEWQGTAETMIAPRNATEAT
LAAIWRDVLKREQVSVTDNFFALGGDSIQSIQVVARARQAGLSLTARQVFEQQTIAALAA
VAGEATTAVAEQGLVSGAVPLTPIQHWFFAQDRAVPDHFNQAVLLDVSALTPDLVMSALD
ALLHQHDALRLRFVRGDNGWQQAHDAGASALRSATLFEAIDLSGLDDAVQGPALRRHAER
LQASLDLAQGPVLRAALFDLGEGHQRLLLIAHHLVVDGVSWRILLEDLGTALSALQRGEP
IRLPAKTTSFRHWAERLVAHARSDAATSELSYWQNQPWHTAPRLPRDHADGANIAADVQL
VKVALDAAETQVLLQEVPEVYHTQINDVLLTALVQAFADLTGAPRLLVGLEGHGREELFD
DVDVSRTVGWFTSLFPVLLDVDGTSDPGTALKRVKEQLRAVPQRGVGYGVLRYLTGADAP
SPDVEVSFNYLGQLDGAAGGQSFGFATEDVGRDQHPSNCRAHLIDVSVHVSDGCLQTQWA
YSPACHDASTVEILAEKFVVELRQMIAHCGTSEGGFTLSDFPLLQNSLSL
NT seq 12393 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagaagctgctctcctcgctgcgccaggacggcgtccagatctggtccgagaac
gggcgtttgcgctatcgcgcgccgaagggcgtcatgacgcgtgagcggctcgacgagctg
cgcgcccgccagctggaaatcgcgacatttctgcaggaggcaagcgcggcgggcgacacg
ctgccgccgatcgaggtcacgcgcagcggcgacctgccgctgtcctttgcccaggagcgt
ctctggtttctcgaacagctcggcctcgccagctcctcctaccatgtcgccgtggcgatc
cgaatggacggtgatctcaatgaggaggcgttgcggaagaccttcgaagccatcgtcgat
cggcatgaagtcctgcggacgcgctttgacaatgtcgcaggacaacccaggcagatcgtg
gagtccaattcgtcatgccgtctggagctgatagatctgtcggctctcgacgaggatgag
caggcggcagaggtcgaccgagaatctatcctccatgccacacagccgttcgatctccag
gcgggctctcccttgcgcatgcggctgcttcgactctcagcccgcgagcacgtgctgctg
ctcgccatgcaccacatcgtctccgacgcgtggtcgatcgaagtgctgatcggcgaaatc
accgccatctaccgcgcgttctgttctggcgagcgcgctccgctcgatcctttgcccgtg
caatatgccgattatgcgctgtggcagcgcggctggctggcgggcgaggttctcgaacgt
cagctgcaatattggaggcagcgcctctccggcgcgccaccgcaactcgagcttccgatc
agccggtcccgttccgcggccacggcctcgaccggcgagacctatgcgttcagcctgtcg
gagaaagccacgtcgcagctgcgggcgctcgcccgcagcgagtccgcgacgttgttcatg
gtcctgctcgcggcgtttcagctgctgttgtcgcgctatagcggccagagcgatgtggtg
gtgggatcgccggtcgctggccgccgccggcatgagctgcacgacctgatcggcttcttc
gccaacattctcgttctccgcgctgattgctcgggaaaccagcgcttcgtcgatctgctg
gcgcaggtcaaggacacggtgctcgacgcccatgcgcatcaggatttgccgttcgagcgg
ctggtcgaggcgctccagccggatcgggatctcgtcaggcatccgctggtccaggtgatg
ttcgcgcttcagcaggagccgttcgaggagctcgtgcttcccggcctgcggctcacgccg
atgcccgcgcggtcgctcgagacgaagttcgatctgacgctgcatgtctacgagaagacg
gccggactcactgcctcgatcgagtatgctgccgagctgttcgatcccgatacgatcgcg
cgcttcgcaactcattttcagcatttgctggaagcgatcgctgcggatccgcatgcgcgg
ctggctgaccttcccctgatgcgggatgccgagcggctcgagatcatcttcggcatgaac
cggaccgcgcggccgttcccgcgagatgcatcgctcgaccaattgttcgcggctcaagcc
gcgcgccggctgcaggccgtcgccatcgtcgacgatgcgcgcagcgtcagctacgccgag
ctcgatcgctggagcaacggcattgcagccgcactggcggcgcagggcgtcaagcccggc
gcgagcgtcgggctctcgggggagcgatcggcgggtctgatcgccggcatgctgggaatc
atcaaggccggcgcctgctacgtgccgctcgatcccggttatccggaggagcggctcgcc
ttcatggcgggggatgccgacctggcggccgtcgtgatgggccgcggcggcgcggcgctg
ccgggcttgccgttgctgcgtgccgaggaggttgagccggtcgagacatttcagtgccga
tcggctggtggtgagaccgtcgcctatatcatgttcacatccggctcgacgggggtgccc
aagggcatcgccgtgcctcatcgcggcatctcccgcctcgtgctgggaacggactatatc
gagctctctgaggatgaccgcatcactcatctcgcgagcccgtccttcgatgcggcgacg
ttcgagctgtgggccgcgctcctgaacggcgccgcgctcgtgatcatcgaccgcgagacc
gctctggactcggaccgcttggccgcttcggtgcgcagccacggcatcagctgcttcttc
gccaccaccgcgctgttcaaccggttggcgcaggatgtcccggagatgttcgcgccgctg
cgcgtggctctgttcggcggcgaggcgtgcgatccgcaggcggtcgctagcgtgctggcc
aatggcgcgccgcaacgcctgctgcacgtctatggtccgaccgaggcaacgacgttcagc
acctggatggaggtcggtcatgtcgcgcccgacgcgcgcactgttccgatcggcggaccg
ctcgccaatggcagctgtcacgtgctcgacgaccggttgcagccggtgcccatcaatgtt
cccggcgagctctatgtcggcggtgatggtctcgcgcacggctattgccgacggcccgcg
ctgaccgcggacaaattcattttcgatccattcggacgtcccggcagccgtctctatgct
accggcgacatcgtcaggcggttggccgacggcaacatcgaatatctcagcaggcgcgac
gggcaggtcaagatccgcggcttccgcatcgagttgcaggagatcgaagccgtgctgcgc
cagtcgcctgaggtcgggcaggcggtggtgctggtccgcgagggcgtgagcggtgcgcag
ctcatcgcctacgtcgtggccgcaccagacgctgagccttcgcccgacgcgcttcgacag
cagctgaagcagtcactgcccgactacatggtcccggcgcagctggtcatcctggacagc
ctgccattgacgtcgaatggcaaggtcgatcgcgcgaggctgcccgatcccgaggagacg
ccaagccgcaggcaggcggcgccggccaccgtgatccagcagatgctggcagtgatctgg
tccgatgttctcggcgtgacaatgccgggtatcgacgatgatttcttcggctccggcggt
cactcgctggtggcgtcgcggctgctcggacgcgtgaacgccgcgttcaacgtgaacctg
ccgctgcgtcgcgtgttcgaggcgccctcgatcaggatgctcgcggccgccgtggagcag
gcacagcgcgacgaggccgacatcgccgcgccgccggtgatcgcggcgccgcgggcgtca
tcgattccgttgtcctatgcgcaggagccgatgtggtttctcgatcaggtcgggctcgtc
ggcgccgcctacaacatggccggggcgcttcggctgcagggcagactcgatgtcgaggcg
ttgatcgcgagcctgcatgagatcgtccgtcgtcatgaggtcctgcgaacccgcttctgc
gttgtggatggtcatggtgtgcagatcatcgggccgggcgaccagcttcagtgtgaggtc
atcgacctttcggcccgtgacactggcgactgggacggcatccaccgtctgatcagcgac
catgcgaacgcgacgttcgatctgcaggctggtccgctgatgcgcacgacgatcgtccgt
gttggcaacgaagagcatctgctgctgatcaaccttcatcacatcgtcgctgatggctgg
tcggtcggcgtgctgtttcgcgaactcggacatctctatggcggccagtgtggggcagcg
caatcggcgctcgcgccacttcccgtccaatatgccgactacgcgatctggcaacggcag
tggctcgatggcgacgtcggcgagtatcagctcgaccattggcgtcgccgcctcgccggc
gcaacaacgacgctggcattgccgacggaccgtccacgtccggcggtgcaatcctttgcc
ggcgcgacgttgcgcttcgcgatgccggccaagctgtccgaccagctgcgggacttggcg
cgtcgggagagcgcgagtctctatatggttttcctcgccgcgttctcgacgctgctgtcc
cgctacagcgatcaacgcgacattctgatcggctcgccggtcaacggacgctcgcggccc
gagctggaagacctgatcgggatgttcgtcaacatgctggtcatgcgttgcgacctcgtg
ggtgatccggcgtttcgcgactacctggccgatatcaaggcgacggcgttggatgcctat
gcgcatcaggatctgccgttcgagaagctggtggatgcgctgcagccggagcgggatttg
tcgcggcaaccgctgttccaggcctgcatgtccttcgagaacattccattcgatgggctg
gagatcgcggggctgacggtctccacggtggccgcggatcagcatccgacgacgaagttc
gatctgacgctcttcgtccgcgagacagcgggcggaattgagtgcgcgctggaatacgcc
acagatctgttcgatgccacgacgatcgcgcggttcgcggatcagttcgtgcgactgctc
caggagatcgcggcacggccggatgcgcgtttgtccgagttcagtttcttgagctccgag
gagcggcagcagctcgaatcgtggagcggcagcagcgccgcctatgcgcaggaccgttgc
ctgcatgagctgttcgccgagcacgcggcacgcgatccggccgcgcttgccgtggtgatg
gagggcgaggagctcagctatggtgcactggagcggcgggccaatcagctggcgcatcac
ctgcagcggctcggcgtcggccccgacgtgatcgtaggtctctgcgttgagcgttcgctc
gacatggtcatcggcgtgctcggcatcctgaaggccggcggcgcctatctgccgctcgat
ccgcgttatccgccggagcggctggcctatatgctcggggatgctgaggtcaccgtgctg
gtgacgcaggctgcggtacgcgagcgcgtgccggcgacggaagcggtcgtggtgcagctc
gatgccgacgctgcggccattgcccggcatccggagacggcgccgctcacgtcctgcgat
cccgatcacctggcctacgtgatctatacctccggctcgaccggacggccgaagggggtg
atgacgtcgcatcgcggcatcatgaacctggcggatgcgcagctcgatcagctgccgctc
acggccggcgatcgcatcctgcagttcgcctcaatcagcttcgatgcggcggtgtgggac
ctggtgatgagctggcgggtcggcgcggccctggtgctggcagatcagcacgatctgatg
ccgggcgagccattgcgtgagctgctcgagcggcagcgggtgacgacagtgctgctgccg
ccggcggcgttggccgcgttgccagtgacgcctttgccggatttgaagatcctgatcgcg
ggcggcgaggcctgcacggcggagctgttgcggccatggctcgcgggccgggccgtgttc
aacgcgtatggcccgaccgagtcgagcgtctgcacgacgatgcatcggtgcggcgacgag
cgacgtccgccgatcgggcgcgcgctgccgaacacgcgcacttacgtgctcgatgcgcag
cttcagccggtgccggttggtgttgccggcgagctgtatatcggcggcgtcggtctggcg
cgcggctatctgcatcggccgtcactgacggcggagcgattcgtgccgagcccgttcgcc
ggcggtgagcggctgtatcgcacgggcgacctcgcgcgatggcgcgcggatggcgtgttg
gactatctcggccgtctcgaccatcaggtgaagctacgcggcttccggatcgagctcggc
gagatcgaggcggcgctgctggcgcaagccggcgtcgcgcaggcggcagtggtgctgcgt
gaggacggcggagccaagcggctggtggcctatgtggtggcccagccgaacgctgccgtc
aacagcgacaacctgcgccagcagctgcagcggagcctgccggactacatggtgccctca
gcgatcgtgccgctcggagcgctgccgctgacgccgaacggcaagctcgaccgcaacgcg
ttgccggcgccggaatggcagggcgcagccgagacaatggtcgcaccgcgcaacgccacc
gaggccacgctcgccgcgatctggcgcgacgtgctcaagcgcgagcaggtcagcgtcacc
gacaacttcttcgcgcttggcggcgactcgatccagtcgatccaggtggtggcgcgtgcc
tggcaggcgggcttggcgctgacggcacgtcaggtgttcgagcagcagaccatcgctgcg
ctggcggcggttgccggcgaagcgacgacggcggtggccgagcaggggttggtgtcgggc
gtagtgccgccgacgccgatccagcactggttcttcgcccaggacctggctgtgccggat
cacttcaaccaggcagttctgctcgacgtcagcgcgctgacgccggacctggtgatgtcg
gcgttggacgcactgttgcaccagcacgatgcgctacggctgcggttcagccgtggagac
aatggctggcagcaagcccatgatgcaggcgcagccgcgctagaatcggcgacactgttc
gaagcgatcgatctgtcgggcctcgatgaacccgtccaggcccccgcgttgcggcggcat
gcggagcggctgcaagcgagcctcgacctggcgcaaggcccggtgctgcgggcggcgctg
tttgatctcggcgaaggccgtcaacgcctgctgctgatcgcgcatcatctggtggtggac
ggcgtgtcctggcggatcctgctggaggatcttggcacggcactgtcggccttgcagcgt
ggcgagccgatccggctgccggcgaagacgacatcgttccggcactgggcggagcggctg
gtggcgcatgcgcgatccgatgcggcaaccagtgagctgagctactggcagaaccagccc
tggcacaccgcacctcggctgccgcgcgatcatgccgatggtgcaaacatcgcggccgac
gtgcaactggtcaaagtcgcactcgacgcagcggagacgcaggtgctgctgcaggaggtg
ccggaggtctaccacacccagatcaacgacgtgctgctgacggcgctggtgcaggcgttt
gccgatctgaccggcgcgccgcggctgctggtcgggctggaaggccacggccgcgaggag
ctgttcgacgatgtcgacgtatcgcggacggtcggctggttcaccagcctgttcccggtg
ctgctggatgtcgacgggacgagcgatcccggcacggcgctgaagcgggtgaaggaacaa
ctgcgcgcagtgccacagcgcggcgtcggctatggcgtgctgcgctatctcggtcatgct
gagatgcgagcgcctgatgtcgaggtcagcttcaactatctcggccagctcgacggcgcc
gccggcggacaaagcttcggctttgctactgaagacgtcggccgcgaccagcatgcctcc
aaccgccgcgcacatctgatcgacgtctccgctcatgtcggcaaggacggcctggagctg
cgctggttctatggcggcgcgctgttcgaggccgccacaatcgagcggatagcgcagcgc
catgtggcggcgctgcgcgagctgatcgcgcattgccggaccagcgccggcgggctgacg
ccgtcggacgtgccgctggcgcagctcgaccaggagacactcgaccgcgtcgtcgcctcg
gtcggcggtgcgagggcggtcgccgacctctatccgctgtcgccgctgcagcgggggctg
ctgttccatagcctgtatgagccggatgcggcagtctatgtgatctcgctggcgtgccgg
ctgcaggggacgctcgacgcggccgcgttcgaacaagcgtggcggctggtcgtggcgcgg
catgcggtgctgcgcaccgccttcgtcggccatgagctcgacaggccgcagcaaatggtg
ctgcgccaggttgagctgccgttcgttcccgaggactggcggcatctctcgccaactgag
caggccgcgcgcttcgccgagctgcaacggaccgagcgcagccgaagcttcgacttcgcg
caaccgccgttgatgcggctgtggttggttcggatcggtgacgacgatcaccggctgttg
tggaacgtgcatcacatcgtgctggatggctggtcgctgccgctgctgctcgacgaggtg
ttcgcggcctatcaggccttgagccggcgcgagacgccggtgctgtccgaggcccggccg
ttcaaggactatatcggctggctgcagcgccaggacatggtccgagcggaagcctattgg
cgccggcgcctcggcgggttcgacacgccatcctcgttcgggctcgcccgtccggcatca
cgtccaagtgccgacgccggtgacacagccgagcgtcatgccgaactgcacggcgagctc
gcgctcgccgatctcgaccgctttgcccggcaacatcggctgaccgtcaacacgctggtg
cagggggcctgggcgctgctgctcgggcgttacggccgctccgacgacgtggtgttcggc
gtcaccgtctcgggccgtccggccgagctcgccggcgtcgagcgcaccgtcgggctgttc
atcaacacgctgccgctgcgggtcgagctgccggggcaggcgacggtgctggactggctg
gccgagatccaggaccggcagagcgagctcacggatcatcaatatacgtcgctcgccgat
gtgcagcgctggagcgagatcagtgaaggcacggcgctgttcgagagcatcgtggcattc
gagaactatccggtggagatgacggcggtcagcggccagcagcagctgcggatcagcgag
gtccagccgctggagcggaccaattatccgctgaccttgcaggtgacggtagggacgacg
ttgtcgttccgcctgatcgcggatacgacacggttcgccgccaacgcggccgggcaaatt
gtggcgcatctggtgcgcctgctcggcgagatcgtcgccgatccggcgcgtcccatctct
gcaatcccgctgctgagcgacgacgagcgccaggaggtggtgcgcggcttcaatgcgacg
gcagcgagctatccgcaagcgctgctgcatgagcagatcgcggcgcaggccaggcagatg
ccggacgcggtggcgctgcgcttcgaggaccagacactcagctatgccgcgctggagcgg
cgcgccaaccagctggcccaccatctgcataatctgggcgtcggtcccgacgtggtcgtg
ggcctctgcgccgagcgctcgctggagatggtgatcggactgctcggcatcctcaaggcc
ggcggcgcctatctgccgctcgacccggggctgccgccggagcggctggcctatatgctg
gaggacgccggggccaaggtgctgctggtgcaggatgcgcttgtcgagcggctgccggca
aatgacgcggtcgtggtgcgcttcgcggcggatgcggcggcgatagcaaagcaggccgag
acggcgccggctacgtcctgcgatccggacaacctcgcttacgtgatctacacgtcgggc
tcgacgggccggccgaagggggtgatgaacagccatcgcggcatcgtcaaccgcatcgcc
tggatgcaggacgcctaccggctgacgcctgacgacgtcgtgttgcagaagacgccgttc
ggcttcgacgtctcggtgtgggagttcttctggccgctgaccgaaggcgccgagctggtg
atcgcccgtcctggtggccatcaggacccggcctatctgtccgagctgatcgagcgtcaa
ggcgtgacggtgatgcacttcgtgccgtcgatgctgcaggcgttcctggaggcggccgat
ctcgatcgctgcggcagcctgcgtgacgtgatctgcagcggcgaggcgctgccggtggag
acgcagaatcggttcctgagcgccttgccatgccggctgcacaatctgtacggcccgacg
gaggcggcggtcgacgtcagcttctggccgtgccggatcgagccggacgccagccaggtg
ccgatcgggcaaccgatcagcaacatccagctctacgtgctcgatgcgcagctcgagccc
gtgccggttggtgttgccggcgagctctacatcggcggcgtcggtcttgcgcgcggctat
ctgcatcgaccgtcgctgacggcggagcggttcgtgccgagtccgttcgccagcggcgag
cggctgtatcgcacgggcgacctcgcgcgctggcgcgccgacggcgtgctggactatctt
ggccggctcgaccatcaggtgaagctgcgcggcttccggatcgagctcggcgagatcgag
gcggcgctgctggcgcaagccggcgtcgcgcaggcggcggtggtgctgcgcgaggatggc
ggagccaagcggctggtcggctatgtcgtggcgcagccggagaccaccatcaatatcgac
acgctgcgccagcagctgcagcggagcctgccggactacatggtgccctcggcgatcgtg
ctcctcgcatcgctgccgctgaccccgaacggcaagctcgaccgcaacgcgctgccggcg
ccggagtggcagggcaccgctgagacgatgatcgccccccgcaacgccaccgaagcgacg
ctcgccgcgatctggcgcgacgtgctcaagcgcgagcaggtcagcgtcaccgacaacttc
ttcgcactcggcggcgactcgatccagtcgatccaggtggtggcgcgcgcgcggcaggcg
ggcttgtcgctgacggcacggcaggtgttcgagcagcagaccatcgctgcgctggcggcg
gtggccggcgaagcgacgacggcggtggccgagcaggggctggtgtcaggcgcggtgccg
ctgacgccgatccagcactggttcttcgcccaggatcgggcggtgcccgaccacttcaat
caagcagtgctactcgacgtcagcgcgctgacgccggacctggtgatgtcggcgttggac
gcactgttgcaccagcacgatgcgctacggctgcggttcgtgcgtggagacaatggctgg
cagcaagcccatgacgcaggcgcatccgcgctccgctccgccacgctgttcgaggcgatc
gacctgtcgggcctcgatgacgccgtgcagggaccggcgctgcggcggcatgcggagcgg
ctgcaagcgagcctcgatttggcgcagggcccggtgctgcgggcggcgttgttcgatctc
ggcgaaggccatcaacgcctgctgctgatcgcgcatcatctggtggtggacggcgtgtcc
tggcggatcctgctggaggatcttggcacggcactgtcggccttgcagcgtggcgagccg
atccggctgccggcgaagacgacatcgttccggcactgggcggagcggctggtggcgcat
gcgcgatccgatgcggcaaccagtgagctgagctactggcagaaccagccctggcacacc
gcacctcggctgccgcgcgatcatgccgatggtgcaaacatcgcggccgacgtgcaactg
gtcaaagtcgcactcgacgcagcggagacgcaggtgctgctgcaggaggtgccggaggtc
taccacacccagatcaacgacgtgctgctgacggcgctggtgcaggcgtttgccgatctg
accggcgcgccgcggctgctggtcgggctggaaggccacggccgcgaggagctgttcgac
gatgtcgacgtatcgcggacggtcggctggttcaccagcctgttcccggtgctgctggat
gtcgacgggacgagcgatcccggcacggcgctgaagcgggtgaaggaacaactgcgcgca
gtgccacagcgcggcgtcggctacggcgtgctgcgctatctcacgggagcggatgcgcct
tcgcctgacgtcgaggtcagcttcaactatctcggccagctcgacggcgcggctggcgga
caaagcttcggatttgccacggaagacgtcggccgcgaccaacatccatccaactgccgg
gcgcatctgatcgacgtctccgtccatgtcagcgacgggtgcttgcagacgcaatgggcc
tacagtcccgcatgtcacgacgcgtccaccgtcgagatcttggcggaaaagtttgtcgtc
gagctccgtcaaatgatcgcgcattgcggcacgagtgaaggcggtttcacgctgtctgat
ttcccgctgctgcagaacagcctgagcctctga

DBGET integrated database retrieval system